GENSCAN 1.0	Date run: 16-Jan-104	Time: 06:54:46

Sequence CLDN1_1 : 19122 bp : 38.31% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1421   1643  223  1  1   87   73   437 0.479  38.86
ccgggcgcggaccccaaccccgacccagagcttctccagcggcggcgcagcgagcagggc
tccccgccttaacttcctccgcggggcccagccaccttcgggagtccgggttgcccacct
gcaaactctccgccttctgcacctgccacccctgagccagcgcgggcgcccgagcgagtc
ATGGCCAACGCGGGGCTGCAGCTGTTGGGCTTCATTCTCGCCTTCCTGGGATGGATCGGC
GCCATCGTCAGCACTGCCCTGCCCCAGTGGAGGATTTACTCCTATGCCGGCGACAACATC
GTGACCGCCCAGGCCATGTACGAGGGGCTGTGGATGTCCTGCGTGTCGCAGAGCACCGGG
CAGATCCAGTGCAAAGTCTTTGACTCCTTGCTGAATCTGAGCA
gtgagtgcacccccacctcacagcggccgtccagaggccccagtccccctgcagctccct
tatgggctcattctgttgtgtgattccatggttatcagtcttcagttgatcaagtcttct
gatcatgtgctctgtcataaggaaatgaagagaatcctggtttgaggaaagcgacgccca

 1.02 Intr +  10591  10755  165  2  0   29   90   119 0.170   5.21
ttttctggagaagatactgtatattgggttaccagcggaaacatcagtatgactggggtc
tctagattcctagtccagttttctctcttccatacaacagtgacatatacttggtcttct
tccatttttctcttgttggtccaagcatatttttacatgttttaaaatgttttctgccag
GCACATTGCAAGCAACCCGTGCCTTGATGGTGGTTGGCATCCTCCTGGGAGTGATAGCAA
TCTTTGTGGCCACCGTTGGCATGAAGTGTATGAAGTGCTTGGAAGACGATGAGGTGCAGA
AGATGAGGATGGCTGTCATTGGGGGTGCGATATTTCTTCTTGCAG
gtaatagaggctgtgcccccctttcaccttactaacctgttcctggtatgatttgaaatc
tattacgttggattcattatacttgatttcagtctctaaggcaaactgcaaacatagacc
tgaagtccagttgactttcatgttctcaaacacaaactaaatgaaaatgtgagagctctg

 1.03 Intr +  13374  13458   85  1  1   82   97    53 0.969   3.56
ttttaatagatacttggaataaatcatatctggacttctaatctccctaataccaaaata
aaaatgtcaacactattgatgagatttaattcttgcaaaatatgttttggtttaacaggt
tgtgtatttaggctcagtgttccatggtgattaacagtcttttgttttgaatttctatag
GTCTGGCTATTTTAGTTGCCACAGCATGGTATGGCAATAGAATCGTTCAAGAATTCTATG
ACCCTATGACCCCAGTCAATGCCAG
gtaacgctattcaggcgtaaaatagtttgttttctgagaaaatgccctttttatattcta
caaagtcctgctagtgccatcatttcccagatttgctttcaagaattttatgtcaaacct
acaaacaatttaaatgatctctgacttatgtcaaaatgagtttgataattgctttaacac

 1.04 Intr +  15188  15344  157  2  1  107   -7    99 0.443   1.39
ttgcaatataaacattctttggcgtgtatgttcagaaatcttaaagtacttcccaaggga
tattcaggggttattttcaatgaaaaaaatacaatgagtattgattttttttccttttat
tatattagaaaagttgccaataattcactgattaacaagcacatgggtttttccttttag
GTACGAATTTGGTCAGGCTCTCTTCACTGGCTGGGCTGCTGCTTCTCTCTGCCTTCTGGG
AGGTGCCCTACTTTGCTGTTCCTGTCCCCGAAAAACAACCTCTTACCCAACACCAAGGCC
CTATCCAAAACCTGCACCTTCCAGCGGGAAAGACTAC
gtgtgacacagaggcaaaaggagaaaatcatgttgaaacaaaccgaaaatggacattgag
atactatcattaacattaggaccttagaattttgggtattgtaatctgaagtatggtatt
acaaaacaaacaaacaaacaaaaaacccatgtgttaaaatactcagtgctaaacatggct

 1.05 Intr +  16902  17054  153  2  0   94   58   113 0.054   8.25
ccttcatgtggttcagtgccttcctctctctaccagtctatttccactgaacaaaaccta
cgcacataccttcatgtggctcagtgccttcctctctctaccagtctatttccattcttt
cagctgtgtctgacatgtttgtgctctgttccattttaacaactgctcttacttttccag
TCTGTACAGAATGCTATTTCACTTGAGCAAGATGATGTAATGGAAAGGGTGTTGGCATTG
GTGTCTGGAGACCTGGATTTGAGTCTTGGTGCTATCAATCACCGTCTGTGTTTGAGCAAG
GCATTTGGCTGCTGTAAGCTTATTGCTTCATCT
gtaagcggtggtttgtaattcctgatcttcccacctcacagtgatgttgtggggatccag
tgagatagaatacatgtaagtgtggttttgtaatttaaaaagtgctatactaagggaaag
aattgaggaattaactgcatacgttttggtgttgcttttcaaatgtttgaaaacaaaaaa

Predicted peptide sequence(s):


>CLDN1_1|GENSCAN_predicted_peptide_1|261_aa
MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSYAGDNIVTAQAMYEGLWMSCVSQSTG
QIQCKVFDSLLNLSSTLQATRALMVVGILLGVIAIFVATVGMKCMKCLEDDEVQKMRMAV
IGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGA
LLCCSCPRKTTSYPTPRPYPKPAPSSGKDYSVQNAISLEQDDVMERVLALVSGDLDLSLG
AINHRLCLSKAFGCCKLIASS