GENSCAN 1.0	Date run: 16-Jan-104	Time: 08:17:58

Sequence BAP1_1 : 11382 bp : 57.29% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1316   1352   37  1  1   78   94    55 0.986   5.36
aggcggagcagggccgtcgcgccttggtgacgtctgccgccggcgcgggcgggtgacgcg
actgggcccgttgtctgtgtgtgggactgaggggccccgggggcggtgggggctcccggt
gggggcagcggtggggagggagggcctggacatggcgctgaggggccgccccgcgggaag
ATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAG
gtgaggaggggaccgggagggccaggggctggggaggccggatgggcccgggacgcgcct
gcctgaccatcaccccctcctcttgtcgccccacccaggcctcttcaccctgctcgtgga
agatttcggtaagagccttttctccctgccggaccggggctgtggcggcccacccctgcg

 1.02 Intr +   1451   1640  190  0  1  105   84   214 0.823  22.55
gagggagggcctggacatggcgctgaggggccgccccgcgggaagatgaataagggctgg
ctggagctggagagcgacccaggtgaggaggggaccgggagggccaggggctggggaggc
cggatgggcccgggacgcgcctgcctgaccatcaccccctcctcttgtcgccccacccag
GCCTCTTCACCCTGCTCGTGGAAGATTTCGGTAAGAGCCTTTTCTCCCTGCCGGACCGGG
GCTGTGGCGGCCCACCCCTGCGCCCTCACTCATCAGGGGCTGTCCTTCCCTACTGCTTTC
CTTTCCTCATCGCAGGTGTCAAGGGGGTGCAAGTGGAGGAGATCTACGACCTTCAGAGCA
AATGTCAGGG
gtgagtggctgtacaccagggctgccccttacacccagagtgctggggaaggtcccagag
aacagggccccttagggaagacagtgccaggaaccctacgttgtaaaatctcacagaaag
cagcagccttgctctctgagtgcccgctcctgatcaaactgatactttcttttctcccaa

 1.03 Intr +   2588   2720  133  2  1   95   46   128 0.852  11.13
ggtgtgtgagggcacaaggccacttcagacacagtgttgggaagaagccaggggagaggg
gggatcacagcaaggacacctgagtgatgacgcagtgcaaaggattaatgggagaaagaa
gggaatgctgattgtcttctcccctttggctgatctggctctgccccttacttcccccag
CCCTGTATATGGATTTATCTTCCTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGAAA
GGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTT
CTTTGCCCACCAG
gtctgctggactctgtgctttgtttggagggtgggatgctgccatgtttttgcttgggaa
gtggaaatggaggaagacaggaggaggagataggcagattctaggggtggtagctacaga
aatcctctggcagaacgaactgaactcttaattcattaaagggaacagctttagagtagg

 1.04 Intr +   3117   3236  120  2  0   67   80   154 0.999  14.36
ccagtgggtatttggtaggtgcttgttaaatgaataaacattaggcaaagatgaaaggag
ctgagaaggggagttgtccagatatgactgacctgctctggatccccattcttgatgtat
atgggcttggggcttgcagtgaggggtgctgtgtatgggtgactattcttggtttcacag
CTGATACCCAACTCTTGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGC
GTGGACCTGGGACCCACCCTGAGTCGCATGAAGGACTTCACCAAGGGTTTCAGCCCTGAG

gtaggctgcagtgccttcatcctggctcacagccaactgggcagatctgaccctgagggc
cactgggaatgctaccacatgatattgggtactattaggctgtttctttttcaaatgatt
gtttatgttacatttgactcttaaataaattgtgtaaggccattgtttttagatgcagtt

 1.05 Intr +   3734   3795   62  1  2  106   89    75 0.987   8.08
agtccatctctttggggctccagagctcttttctgcccccaccagccttttaagaaagtt
cgtctgtgttccttccgattcctggaatgcctccaggctgctctctgaagctttgccttc
cacccatagtcctacctgaggagaaattattctgatacggccttattttcttccccgtag
AGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCC
AG
gtgtgtgggagctgtgggagctgatgtggggtgggagtagggggagtatcattttttggg
ccctgactctgtttttccccaggcccgagccacgccacctccctgagaagcagaatggcc
ttagtgcagtgcggaccatggaggcgttccactttgtcagctatgtgcctatcacaggcc

 1.06 Intr +   3878   4020  143  2  2   95   66   148 0.999  14.48
aattattctgatacggccttattttcttccccgtagagcaaaggatatgcgattggcaat
gccccggagttggccaaggcccataatagccatgccaggtgtgtgggagctgtgggagct
gatgtggggtgggagtagggggagtatcattttttgggccctgactctgtttttccccag
GCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGA
GGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCT
GAAGGTCTACCCCATTGACCATG
gtaggcaccatgagctggaggcctgttgggtgtctctgcctacctcctagggagctgggg
ctcagggccctctggtatgtggtacccagtggcaggggttgtcggtaccgacacccggct
ctggctggggtttcaccctacaccatattgcccgaccagctcctgattccctggctcaac

 1.07 Intr +   4287   4365   79  1  1  103   86   119 0.999  12.96
cagtggcaggggttgtcggtaccgacacccggctctggctggggtttcaccctacaccat
attgcccgaccagctcctgattccctggctcaactgctcttctctgtcttccttcccact
cctggcctgcccaaactcagggtttccttctcgctgattccttgtcttggtctccactag
GGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGTA
TCGGCCTCGCCACTGCAGG
gtaagggccctgtgcctgccctgttctactctctggagctgtacctactttgggagggac
agagagtatccaggtgatttgtaaattgcaaggccatatggtgaatctggcaagatcagg
cttagatcatgggttctcaacttgttgtcttatttcctgcctgggctgcctgtggcctgc

 1.08 Intr +   4818   4941  124  0  1   69   96   237 0.999  24.36
tgttggaaggtaccagctcaggtgcctggcatgtatggctagtcgctgcctgcctgttgg
ggtggggcctatacctacagctgcaggtgtgactgcagggagccctgccaggatatctgc
ctcaacctgatggcggggccggggcgggagctgctctcacggctgcggctgtgactgcag
GGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGTGGTGCCCGACCGCAGGATCAA
GTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCA
GCAG
gtaggtgccctttcttcctggcctctgcccagcccaaccctccctgcattcctcctccct
tcccccacagcatttgtctctgattcgtgaacatactctcttgtagatctgggcttcagc
taaccacatcttttctttgcccccattgtgggaaaggtgggacttggagtggggagggag

 1.09 Intr +   5282   5429  148  1  1   45   84   161 0.995  12.39
gacttggagtggggagggagaatagcttctaaaaggaagtttgggtttgggtgttttatt
tccctgtgagtgaatgggtagagccaaggccattattcctttaggtcctcagcccttagc
tatttaaggtagaagcccgggtctaccctttctcctctgagccctggattctgttgttag
CTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTG
CCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCC
CCTGCAGCCTCTGAGGGCAACCACACAG
gtactggggggtttgggacctcttgtggacctcagagccacccgctaatgtctgacatgg
gaggcctaaacagggaaagtctttttctggggatgtccttgggcagtgttcttcccccgt
cagaaggtagagggagagcagtccttccctaaagaaaggcacctgtaaagggccgctgtt

 1.10 Intr +   5900   6084  185  0  2   91  115    97 0.999  13.41
ccatctcattctttgccctgtctcattgcgggatcatgacttagagcttgctgactccca
ttgcaccagctggctgggctgttcttctctgggaagtgctggttcacagggccggggaga
ctgtgagcttttcttggagatcctactggaggtcctgcctgtgttcttgccctgtctcag
ATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACA
AACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCA
CTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCA
TGCAG
gtaagctgggagcacccttgcaggattctctacttgattctcttgagaggctgcaacagg
caattttcccatgtggttccttggtgttcatccttggcatggctgggtcaagctgcctgg
gcctgggttgctaggttcctctgcctgatatgaaaaggcccccacaacagcaggagctta

 1.11 Intr +   6608   6741  134  1  2   87   48   275 0.979  24.02
tctatccagtgtaagtgggtggcagcctccccacaagccaaggacaggccatggaacagc
tggaggggttccgctgactcagtctggaaaaccatgttggctttctctctggctgtgagt
gtctaggctcagcctgggccgagcagcacttgtttgtaactgccctggtctttgtcccag
GAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAG
CAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACC
AACTCTGCCCTTAG
gtcagcccagctttctaaggctaccaggttctaggtgcttcggatcccatcctgaatatc
tcagtctgtgtctgagaatgccctgcagcagataatgttgagcacctgcggagtttgggg
ccctgggggaggctggcatgatggggctgaccccaggtccccaggaagtttttggtgggc

 1.12 Intr +   7300   7778  479  1  2  103   80   515 0.999  46.25
ggctgcagctgtcagaacttgatgccaggcttagcatggctagttcaagttgcttggacc
aagtataaggagttttagggtcagcccctggaggtcgggatgtatttaagccattctggg
tactgctgggtatggtcacctggcccgttcccttgcttcacatcttctcgggccccacag
GTATAAGGGGAAGGGAACAGGGAAGCCAGGGGCATTGAGCGGTTCTGCTGATGGGCAACT
GTCAGTGCTGCAGCCCAACACCATCAACGTCTTGGCTGAGAAGCTCAAAGAGTCCCAGAA
GGACCTCTCAATTCCTCTGTCCATCAAGACTAGCAGCGGGGCTGGGAGTCCGGCTGTGGC
AGTGCCCACACACTCGCAGCCCTCACCCACCCCCAGCAATGAGAGTACAGACACGGCCTC
TGAGATCGGCAGTGCTTTCAACTCGCCACTGCGCTCGCCTATCCGCTCAGCCAACCCGAC
GCGGCCCTCCAGCCCTGTCACCTCCCACATCTCCAAGGTGCTTTTTGGAGAGGATGACAG
CCTGCTGCGTGTTGACTGCATACGCTACAACCGTGCTGTCCGTGATCTGGGTCCTGTCAT
CAGCACAGGCCTGCTGCACCTGGCTGAGGATGGGGTGCTGAGTCCCCTGGCGCTGACAG
gtgggccttggactggctcactggccacttggtgcacccaggagggaggagggaagtggc
caagtgaccacaaagtgtcctgcactctgatgattttcttgtgacctctcttcccagagg
gtgggaagggttcctcgccctccatcagaccaatccaaggcagccaggggtccagcagcc

 1.13 Intr +   7896   8056  161  1  2   91  105    87 0.905  11.60
tcatcagcacaggcctgctgcacctggctgaggatggggtgctgagtcccctggcgctga
caggtgggccttggactggctcactggccacttggtgcacccaggagggaggagggaagt
ggccaagtgaccacaaagtgtcctgcactctgatgattttcttgtgacctctcttcccag
AGGGTGGGAAGGGTTCCTCGCCCTCCATCAGACCAATCCAAGGCAGCCAGGGGTCCAGCA
GCCCAGTGGAGAAGGAGGTCGTGGAAGCCACGGACAGCAGAGAGAAGACGGGGATGGTGA
GGCCTGGCGAGCCCTTGAGTGGGGAGAAATACTCACCCAAG
gtgagcctccgttgtggttttctcctttaatcctggcagagggtaaggcctgagctcctc
ctgcccaggtgccaagttcttgattggaactttggtgtgaagattggtggctggagccat
gtgccagaagactttctgggttgggtggtggcaggggccttgataggcatggactcgctg

 1.14 Intr +   8254   8415  162  0  0   78   98   135 0.986  14.87
ttttctcctttaatcctggcagagggtaaggcctgagctcctcctgcccaggtgccaagt
tcttgattggaactttggtgtgaagattggtggctggagccatgtgccagaagactttct
gggttgggtggtggcaggggccttgataggcatggactcgctgctcatccttgcctctag
CTGCCTATTGCTCGTGGGGCTTTGTTGCTGGCCCGCCCCGATCAGAGGTGCAATGCTGGG
TTTTGGCAGGAGCTGCTGGCACTGCTGAAGTGTGTGGAGGCTGAGATTGCAAACTATGAG
GCGTGCCTCAAGGAGGAGGTAGAGAAGAGGAAGAAGTTCAAG
gtgggtgatttctccagttgcctgatctggcctctcccgaggtccactggtggctgctct
ggcaagattggctccagtgctctcagtcttcttctctcctacagattgatgaccagagaa
ggacccacaactacgatgagttcatctgcacctttatctccatgctggctcaggaaggtg

 1.15 Intr +   8520   8592   73  2  1  109  100   123 0.969  15.73
gaagtgtgtggaggctgagattgcaaactatgaggcgtgcctcaaggaggaggtagagaa
gaggaagaagttcaaggtgggtgatttctccagttgcctgatctggcctctcccgaggtc
cactggtggctgctctggcaagattggctccagtgctctcagtcttcttctctcctacag
ATTGATGACCAGAGAAGGACCCACAACTACGATGAGTTCATCTGCACCTTTATCTCCATG
CTGGCTCAGGAAG
gtgaggggatgcgctgctgtcttaactggaatgccctgctgagggccgtgtccttcagct
cccctcccctggcctctcctgaggcttgagcagaccttggggcacagggagggccatgag
agcctcagctcctggcctgaggcagccagcacctgctcaagggtctctacctcttcgcag

 1.16 Term +   8773   8906  134  2  2   95   55   237 0.326  20.29
gtgaggggatgcgctgctgtcttaactggaatgccctgctgagggccgtgtccttcagct
cccctcccctggcctctcctgaggcttgagcagaccttggggcacagggagggccatgag
agcctcagctcctggcctgaggcagccagcacctgctcaagggtctctacctcttcgcag
GCATGCTGGCCAACCTAGTGGAGCAGAACATCTCCGTGCGGCGGCGCCAAGGGGTCAGCA
TCGGCCGGCTCCACAAGCAGCGGAAGCCTGACCGGCGGAAACGCTCTCGCCCCTACAAGG
CCAAGCGCCAGTGA
ggactgctggccctgactctgcagcccactcttgccgtgtggccctcaccagggtccttc
cctgccccacttccccttttcccagtattactgaatagtcccagctggagagtccaggcc
ctgggaatgggaggaaccaggccacattccttccatcgtgccctgaggcctgacacggca

 2.02 PlyA -  10724  10719    6                              -1.95
 2.01 Term -  10869  10748  122  1  2  120   38   140 0.982  11.77

Predicted peptide sequence(s):


>BAP1_1|GENSCAN_predicted_peptide_1|787_aa
MNKGWLELESDPGLFTLLVEDFGKSLFSLPDRGCGGPPLRPHSSGAVLPYCFPFLIAGVK
GVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQ
LIPNSCATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGYAIGNAPELAKAHNSHA
RPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRLFELDGLKVYPIDHGPWGEDEEWTDK
ARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKYEARLHVLKVNRQTVLEALQQLIRV
TQPELIQTHKSQESQLPEESKSASNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPS
HSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAFLDNHNYAKSPMQEEEDLAAGVGRSR
VPVRPPQQYSDDEDDYEDDEEDDVQNTNSALRYKGKGTGKPGALSGSADGQLSVLQPNTI
NVLAEKLKESQKDLSIPLSIKTSSGAGSPAVAVPTHSQPSPTPSNESTDTASEIGSAFNS
PLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLRVDCIRYNRAVRDLGPVISTGLLHLA
EDGVLSPLALTEGGKGSSPSIRPIQGSQGSSSPVEKEVVEATDSREKTGMVRPGEPLSGE
KYSPKLPIARGALLLARPDQRCNAGFWQELLALLKCVEAEIANYEACLKEEVEKRKKFKI
DDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSR
PYKAKRQ

>BAP1_1|GENSCAN_predicted_peptide_2|40_aa
XTLSTTGHSTNYVIAVEIPTHQPQRHWIKRGVALICALDY