GENSCAN 1.0	Date run: 16-Jan-104	Time: 04:06:09

Sequence XBP1_1 : 8411 bp : 45.23% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1249   1475  227  0  2   74   64   246 0.977  17.21
tccatagccacggtcctgaaacgccccgccgggcaggccggaccaatggacgccgagctc
ggccgtgcgtcacgcgacgctggccaatcgcggagggccacgaccgtagaaaggccgggc
gcggcgaggctgggcgctgggcggctgcggcgcgcggtgcgcggtgcgtagtctggagct
ATGGTGGTGGTGGCAGCCGCGCCGAACCCGGCCGACGGGACCCCTAAAGTTCTGCTTCTG
TCGGGGCAGCCCGCCTCCGCCGCCGGAGCCCCGGCCGGCCAGGCCCTGCCGCTCATGGTG
CCAGCCCAGAGAGGGGCCAGCCCGGAGGCAGCGAGCGGGGGGCTGCCCCAGGCGCGCAAG
CGACAGCGCCTCACGCACCTGAGCCCCGAGGAGAAGGCGCTGAGGAG
gtgggcgaggggccggggtctggggccagatctgaagccgggactagggacaggggcagg
ggcaggggctgggagcggggacccagcactggccgccccgcagggctccgtcgcctttgg
cctggcgggtcggtgccagcgtggcgcggggcggggcaggaagcccggactgaccggatc

 1.02 Intr +   2620   2716   97  1  1  123   83   123 0.909  15.31
attgacagaagactgtattttttattttgttttattgaggggaggagcctgaagtgtatt
ttatcattagtctgtcttatactgtaaataaaaatgaaagcaccagctggtaaagttttc
aaataaagacataaataaggtttgatatgactcagtgtggtatgttccttctcttcctag
GAAACTGAAAAACAGAGTAGCAGCTCAGACTGCCAGAGATCGAAAGAAGGCTCGAATGAG
TGAGCTGGAACAGCAAGTGGTAGATTTAGAAGAAGAG
gtaaaactacttaaggtcaaactcttttatccattgtatacccttccttggtgaatgttc
tgatatttgcttcccatcccaagttgtttcagcccctattagaatacaattgaatatatg
attaaaagttaaactaggctgggcatggtggctcatgcctgtaatcccagcactttggga

 1.03 Intr +   4568   4696  129  1  0   76   94   112 0.941  11.49
ttattaagtagcttgcttttccataattatggcctagctttttaaaacctactatgaaca
ccacaagcatagagttttccaaaagttcaagaaggaaaggaaaccaattatactgaatca
ggtagattcttaactgaaataattagatgttttaatagcctcttatgaactttcttccag
AACCAAAAACTTTTGCTAGAAAATCAGCTTTTACGAGAGAAAACTCATGGCCTTGTAGTT
GAGAACCAGGAGTTAAGACAGCGCTTGGGGATGGATGCCCTGGTTGCTGAAGAGGAGGCG
GAAGCCAAG
gtaaatcatctcctttatttggtgcctcatgtgagtactggttccaagtgacatgaccca
gcgattatgtttacagtctggacttctgatcaagagcgttcttgaaattttccttcagtt
ttaagacattttcatgcaggcagagtgttcttcccctaaaggcacttgacactcattttt

 1.04 Term +   6041   6598  558  1  0   88   49   167 0.914   7.15
tcctagttccaggtaatatagaacatggagtgaagtgtagataaatgggtctggtgggtc
ccgaggtcatcttatcacataatgactaatttacattatggaacccagtacaaagtgttc
cagttagattttccattgtattctgacagttgtacttcatttaatttttgcctcttacag
TCTGATATCCTGTTGGGCATTCTGGACAACTTGGACCCAGTCATGTTCTTCAAATGCCCT
TCCCCAGAGCCTGCCAGCCTGGAGGAGCTCCCAGAGGTCTACCCAGAAGGACCCAGTTCC
TTACCAGCCTCCCTTTCTCTGTCAGTGGGGACGTCATCAGCCAAGCTGGAAGCCATTAAT
GAACTAATTCGTTTTGACCACATATATACCAAGCCCCTAGTCTTAGAGATACCCTCTGAG
ACAGAGAGCCAAGCTAATGTGGTAGTGAAAATCGAGGAAGCACCTCTCAGCCCCTCAGAG
AATGATCACCCTGAATTCATTGTCTCAGTGAAGGAAGAACCTGTAGAAGATGACCTCGTT
CCGGAGCTGGGTATCTCAAATCTGCTTTCATCCAGCCACTGCCCAAAGCCATCTTCCTGC
CTACTGGATGCTTACAGTGACTGTGGATACGGGGGTTCCCTTTCCCCATTCAGTGACATG
TCCTCTCTGCTTGGTGTAAACCATTCTTGGGAGGACACTTTTGCCAATGAACTCTTTCCC
CAGCTGATTAGTGTCTAA
ggaatgatccaatactgttgcccttttccttgactattacactgcctggaggatagcaga
gaagcctgtctgtacttcattcaaaaagccaaaatagagagtatacagtcctagagaatt
cctctatttgttcagatctcatagatgacccccaggtattgtcttttgacatccagcagt

Predicted peptide sequence(s):


>XBP1_1|GENSCAN_predicted_peptide_1|336_aa
MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARK
RQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLR
EKTHGLVVENQELRQRLGMDALVAEEEAEAKSDILLGILDNLDPVMFFKCPSPEPASLEE
LPEVYPEGPSSLPASLSLSVGTSSAKLEAINELIRFDHIYTKPLVLEIPSETESQANVVV
KIEEAPLSPSENDHPEFIVSVKEEPVEDDLVPELGISNLLSSSHCPKPSSCLLDAYSDCG
YGGSLSPFSDMSSLLGVNHSWEDTFANELFPQLISV