GENSCAN 1.0	Date run: 16-Jan-104	Time: 03:51:13

Sequence TOP3B_1 : 28143 bp : 54.81% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.03 PlyA -    893    888    6                               1.05
 1.02 Term -   1075    897  179  2  2   53   38   115 0.689   1.17
 1.01 Init -   1281   1122  160  0  1   58   70   124 0.683   5.56
 1.00 Prom -   1785   1746   40                              -1.41

 2.01 Init +   8267   8336   70  1  1   80   75    84 0.755   7.46
tctttgttaaagtgattttccttgtagtggtgtaggttctattgacagcattgctatcct
gagtgtcttttcttctctttaggagtcagcattggtaatagtgctgtgctgcggaagagt
ggagtctaaactttttcattgccagtgccccgaaactggagtgtgaaggaccgagacaaa
ATGAAGACTGTGCTCATGGTTGCTGAAAAGCCGTCCTTGGCACAGTCAATTGCCAAAATC
CTCTCTAGAG
gtaggagagaccagccctgctttggtctgtaagcacggtcgtttatgtgttacaggacat
tttttcctaatgtgattccaccctggctggggtagatttggttcgggtcggcaggtggta
atgaagcatctcagtatgtcacagtggggtgcatttgcttccactcctggcaatgtgcca

 2.02 Intr +   9488   9619  132  0  0  104   94   139 0.994  17.22
cctgagcgccgtcccacctctcagtgcccaactacccgcaccagtctgcggaatgtcgtc
actcaccactctggggaaggaggactctggccctctgggaggtggcatccgggctggggt
ctccacagggtcttcagctcagctgaagcagccagtcactttgtgcttcctcatccccag
GGAGCCTGTCCTCACACAAAGGGCTGAACGGGGCCTGCTCAGTCCACGAGTACACTGGGA
CCTTTGCTGGCCAGCCAGTGCGCTTCAAGATGACGTCTGTCTGTGGTCACGTGATGACCC
TGGATTTCCTGG
gtaagcccctctaccctccatcctactgaagggagttctgcatggcactggccagggtcc
agttgaagccaggagatgcctctaggcagggaagtttgtcccaactccatgagtcataag
gccagcagatcatgaagtagcaatgagagggtccctggtgcggtgcccagaacccaggct

 2.03 Intr +  11258  11364  107  0  2   81   96   164 0.998  16.93
gttaccaaaggcctgaacccacatcctggctctgcctctgatcatcaggatgaccctggg
caaattgttctccaagctttcccctcctcatttgtgggatgaggccaacatcctcctggg
gttatgatggtctcggaggctgagctcctgtgactcaatgtcactgtgactggtttgtag
GAAAATACAACAAATGGGACAAAGTGGACCCCGCAGAACTGTTCAGCCAAGCTCCCACGG
AGAAGAAAGAAGCTAACCCCAAGCTGAACATGGTGAAGTTCCTGCAG
gtgcgtggggctggcctgggcatgagcacaccggggctccccaccctccacagctgccat
gtctttgcccacccttgcttgagtcctaatcccccttggacaggggggcctttgctagct
ttttctgtgagtgccccctgctggcccacgaggcacctgcaggcacccccaacacacaag

 2.04 Intr +  12025  12099   75  0  0   69  105   119 0.952  11.91
attcttttctgttggctgagccagcctcaacacagccagctccttacccagcccaggtac
cagtcctcctaactgaggttcagggcctgggaccaagccctgtcctggatgggagcactg
ggggcgggtggcacagaccgggtctgcagcaggtacgtgtgaacctgtgctgtgtggcag
GTGGAGGGCAGAGGCTGCGACTACATCGTGCTGTGGCTGGACTGCGACAAGGAGGGGGAG
AACATCTGCTTTGAG
gtgagtgtgaggctcactttgttcctcacttttggcctttctgacaccagccccaaactg
acaccagcagtcagtcacatcactcctggggccaaaggagggagtaaactgtaccggttt
aaaaacacctctcccctccctttattctgaaactccacagatacttttaactgcataggc

 2.05 Intr +  12674  12739   66  1  0   94   65    29 0.590   0.79
ggcctcgctctgctcatctcctgcctcatccaggatgcctcctgcctccagccaaccctg
ggagccctgcagagaagcaggtggcagctgctccctgtgcacaccccatgccccatgctt
gccccggccatggtgccctcacagtggccatgactgctggtctcacttggtgcccttcag
ACTGTTGTTCTATGGGTCGCCCCCGTGCTCCTGTACCCCCAGCTCTCACCCGTGGCTCAA
GAGCTG
gtcagtgagacagagctgaggcacctggcgttgcagtacagcaccctcagcaaatgcgat
cacactctgtctcttcccagataccctctcctcccctgcagggcggctcctccctggggg
cctttgcatctgggaatggagaatgggggcagctcatggggctttctcccttcagaaatg

 2.06 Intr +  13570  13766  197  0  2   74   53   361 0.999  29.93
agggggatagaggagggtctggcaggtgcaggaaaggggatagaggagggtctggcaggg
gcaggagagggagccgagcacacgtgttctttcctggaaggaaccaggcttcacagtggg
gtggggagctgtggcagggatctgggaggtgggtcacagctggccactccccacccccag
GTTCTTGATGCTGTTCTGCCCGTCATGAACAAGGCCCATGGTGGCGAGAAGACCGTGTTC
CGGGCCAGGTTTAGCTCCATCACGGACACAGACATCTGTAATGCCATGGCCTGCCTAGGC
GAGCCTGACCACAACGAGGCGCTCTCAGTGGATGCTCGCCAGGAGCTGGACCTGCGAATC
GGCTGTGCATTCACCAG
gtgctggccacacccgcagagtcctgggcacaccctcactctccctcagccagagacctg
cctctactggtccccctccggggcccctaggcctcctcgagccaggatgagcaacagggg
atttcaccaaccctgaagaaggccaggcacagtggctaacacctgtaatccctgcacttt

 2.07 Intr +  15201  15357  157  0  1  107   16   123 0.979   7.53
tacacacatgaatcctccctaaggctatgcccactctgctcccactggcttctaagtggg
gacaccacctgatgccacctccttcatgcaccacccctggccttgggctggactcacatg
ggtggccataatagtgtcttgagtgaatcagtgaccaaaatatctttccactccctccag
GTTTCAGACTAAATATTTCCAGGGGAAATACGGTGATTTAGACAGCTCTCTCATCTCCTT
TGGGCCGTGTCAGACTCCAACCCTGGGATTCTGTGTGGAGAGACATGATAAAATCCAGTC
CTTCAAACCAGAGACCTACTGGGTGCTGCAGGCCAAG
gttccttgcctttctctattcatgctggggctttctgggtttggggcatggattctgaga
gtcttccatcatcatcagccggcaggccccgggctgagggcagaagtgtggacggctgta
cctggaagtggtctgtggtgcctagggctgagggaccccagccttcatgggggcagtggg

 2.08 Intr +  16260  16373  114  2  0  134   69    77 0.733  11.55
agagggccagatgtcagcttgcgtatctgcccacctgaacaggtacagctgtgagccatt
acagccagggctatttggctcccagacaaggaccagcttcatctgtcctggttcttcctg
gcgttgggctcacctggagactttttcttgtgcgttcaccctttatcctttttcctgcag
GTTAACACTGACAAAGACAGATCTCTCCTTTTGGACTGGGACCGAGTAAGAGTGTTTGAC
CGGGAGATCGCACAGATGTTTTTAAACATGACAAAGCTGGAGAAGGAAGCCCAG
gtgtgcctgctccacccacatctatcacagttgccttgggtgagggtggcccttggatgc
ctcccgctggaggaacagcctgtgatcctagtccacgtctttctccccctttctgaaaca
cagacatctttttggaaagctgaatggttactccctcatatactcctaagatatttctgc

 2.09 Intr +  18601  18691   91  0  1  129   71   100 0.998  12.47
tctttttcctttcctggtcctgaataaatattcaatcaagtctttagactgttgggaaga
atgaattggagaaacagggagaccagatgaatgaaaccagacccttcgtccacacatctt
gattccctctatggtggtgtcttcctccttccccaaatcattgactgtcctgtcttccag
GTGGAGGCCACAAGCAGGAAAGAAAAGGCCAAGCAGAGGCCCCTGGCCCTGAACACTGTG
GAGATGCTGCGTGTGGCCAGCTCTTCTCTGG
gtatgtagggacatttctctcaagtcaccagaaggcttcctgaggcaggttcagcctgga
gcagcgagtgcccagggttgcaggatggtgcccaaggcttcaaggggatctgagcctcag
gaggatttcacttatccttaggttgtaaaggtggtaaagttggtcaccacctgaggggac

 2.10 Intr +  19661  19815  155  0  2  105  113   301 0.997  34.60
actgtgtggcataggtgcccacccggccagcagctttgcactccagctgtgcctgctcag
agccaccgtcaccctccaggaggggccggccacaatgggggagcctgagtgcataggcca
gggcaggcagctggccatccccacgtacctggccctctgagaacctcctgtctctcgcag
GCATGGGGCCGCAGCACGCCATGCAGACGGCTGAGCGGCTCTACACGCAAGGCTACATCA
GCTACCCACGGACAGAGACCACCCACTACCCTGAGAACTTTGACCTGAAGGGCTCTCTGC
GGCAGCAGGCCAACCACCCCTACTGGGCCGACACG
gtgagtggagccgggccggcctcagcatgtgtgtgtgtcactgaggccttgggaccaggt
ctggtacgtcagccaaacccaggcaggcagccgagcccagccacagactctgctctgtct
tctctccctcaggtgaagcggttgttagcagaaggtatcaaccgcccgcggaaaggccat

 2.11 Intr +  19948  20053  106  0  1  140   54   131 0.979  15.19
aagggctctctgcggcagcaggccaaccacccctactgggccgacacggtgagtggagcc
gggccggcctcagcatgtgtgtgtgtcactgaggccttgggaccaggtctggtacgtcag
ccaaacccaggcaggcagccgagcccagccacagactctgctctgtcttctctccctcag
GTGAAGCGGTTGTTAGCAGAAGGTATCAACCGCCCGCGGAAAGGCCATGACGCCGGCGAC
CATCCCCCCATCACCCCCATGAAGTCTGCCACAGAGGCCGAATTAG
gtaccgctctcatcccatacccggtgtgcttccagggagggaagggcgagctgcgacagt
gaaggttgcaggccctgttggcaatgtgggggctccttcagcctctgcctgccctggctg
tggggatggggggccacctggaagatgagctccattgctatgggaccaggacaggagtga

 2.12 Intr +  21083  21229  147  0  0   98   42   315 0.983  28.62
gcatgagccaccacgcccggccttcctgcacattttctttcctccttccccaggatttgc
agtgtgtcctgcacagcggctctgtaagcaggagcttgctgctcgagcgagagtactggg
ggctcctcacggccagagcccccagctggctcccaactgactagccctggcctgttgcag
GGGGTGACGCGTGGCGGCTCTATGAGTACATCACCAGACACTTCATCGCCACGGTCAGCC
ATGACTGCAAGTACCTGCAGAGCACCATCTCCTTCAGAATTGGGCCCGAGCTCTTCACCT
GCTCCGGGAAGACCGTCCTCTCACCAG
gtcacaccacgggcccagccttcctcctctgtgccttcatgggcagacaaacattctaca
tcgtgtctggggatgggaggcccagggtctgaggccccggccacccaggctggggaccct
gagtggcggcgcatatctctccaggcttcacggaggtcatgccctggcagagcgtgcccc

 2.13 Intr +  21374  21547  174  0  0   66   72   304 0.933  27.03
tcttcacctgctccgggaagaccgtcctctcaccaggtcacaccacgggcccagccttcc
tcctctgtgccttcatgggcagacaaacattctacatcgtgtctggggatgggaggccca
gggtctgaggccccggccacccaggctggggaccctgagtggcggcgcatatctctccag
GCTTCACGGAGGTCATGCCCTGGCAGAGCGTGCCCCTGGAGGAGAGCCTGCCCACTTGCC
AGCGGGGTGATGCCTTCCCTGTGGGCGAGGTGAAGATGCTGGAGAAGCAGACGAACCCAC
CCGACTACCTGACGGAGGCCGAGCTCATCACGCTCATGGAGAAGCATGGCATCG
gtgggtgcgcctgcccaggccccagagccggctccgtctccagtactcaggcttcgagtc
tactcacaaagctgccccgccagccctgtgtgcccagcccagcacccctccatgggctgg
tatctggaaactggtgacccagtgtgtggccagccaggcaggtccacagcgggcatcccc

 2.14 Intr +  23527  23655  129  2  0   44   97   277 0.987  25.37
aatgcatgcagttggtgcccagcacagtgcagggggagctcagggcacagccctccctcc
tgtgaccgggagcagtgagagggcctgagcaccaggggccccgtgacaggtgatacagca
catggttcagtggggcatgtccaaggcaggccaggaaccctggggccttgtacattgcag
GCACGGATGCCAGCATCCCTGTGCATATCAACAACATCTGCCAGCGCAACTATGTCACGG
TGGAGAGCGGGCGCCGGCTCAAGCCCACCAACCTCGGCATCGTCCTGGTGCACGGCTACT
ATAAGATTG
gtgagttcctcagtcctgcccccagggcccaccgaggctccctggcttctccctggatgt
tggctctgctgcccgctccagacaggcccctgccctacagtgatcccccagccccacaca
cactccctcaacacccgctgaaggggtgctgccccaggacccccaggacctgcccagagc

 2.15 Intr +  24240  24389  150  1  0   86   40   312 0.989  26.85
tctggggtcataagagccagcctggtaccatctgaggctgtggactggtgggtagggcag
aggccaggaggacgggccagagcgggaggggtgaacagggcagtatccctgcctgggaag
gggtggcatggccctgggtgcgagtgctcagggcaatatctgccccctgcccacttgcag
ATGCAGAGCTGGTGCTCCCCACCATCCGCAGTGCAGTGGAGAAGCAGCTGAACCTGATCG
CCCAGGGCAAGGCCGACTACCGCCAGGTCCTGGGCCACACCCTGGACGTGTTCAAGAGGA
AGTTCCACTACTTTGTCGACTCCATTGCTG
gtagagtctgcctctggcctgcccctcaccagaggggtgtctctctgtcagcaaggccag
tacctggggacccaggtccccacgtgggaccagctcccagatctgggcttcaggcctccg
taggccaggtcagtgacacctcctggctgggttgaaagagcaggtgcattaacaccacac

 2.16 Intr +  24744  24844  101  1  2  100   96   144 0.999  16.73
ccacacatggccaggaacacgtgcctctgacgcacagggctgctgccctgccgtgctgcc
aggacagtagaaaccaccgcctatagggaccctttcacactcagacccttgaccacgtgt
tgcggagccttttgctggggactgggagggagatgactcctgcactctgcttgcccgcag
GCATGGATGAGTTGATGGAGGTGTCTTTCTCGCCCCTGGCGGCCACAGGCAAGCCCCTCT
CACGCTGTGGGAAGTGCCACCGCTTCATGAAGTACATCCAG
gtaggtgcagggaacactagctcaggcaagctgcctcacccctgtaggcctcagctttat
cgttgatcagcaggaatcatgttctttgtcctggttgtcacaaaagaatgatggaacata
aagaggccttgccaaaaaatacccagtgtccccacgtcccctagaatacacagccattag

 2.17 Intr +  25283  25484  202  1  1   96  113   398 0.990  42.48
ttttagaactgccttttctgcacgcgtggagcaagagccagagactcatgctccttgcct
ggcagtgtgtcacaggttctgcatgacagattacatactttgtattatgagaggagtggg
ggtgggtgccaagtcggtggccccagtgaccctcacgccacctgcctggcattgccgcag
GCCAAGCCAAGCCGCCTGCACTGCTCCCACTGCGATGAGACCTACACGCTCCCCCAGAAC
GGCACCATCAAGCTCTACAAGGAGCTCCGCTGCCCTCTGGATGACTTCGAGCTGGTCCTG
TGGTCATCAGGCTCTCGGGGCAAGAGCTACCCGCTGTGCCCCTACTGCTACAACCACCCA
CCCTTCCGAGACATGAAGAAAG
gtgagtgcagccactccctcctgtccacaggtagctgcagtctcttttcagtgccaaccc
ctgccttgcaccaggctggactctgaggggacccctcaccctggcctttcctgcactcat
tggcactgagacgagagaccctggatgtagctggggcactgcttaggcctcagccagtgg

 2.18 Term +  26381  26862  482  0  2   73   45   609 0.900  50.44
aaaacaggggtaatggcagccaggagccgaaacatgagcaaggctgtccccaagagcaag
gccaagaagagttccttctgctgggacgagggatccaggagcttgaggcattgggagcag
gcagcagagggcaggtgggcacagtgggcgtgcctttacagggctcccttctcccgccag
GCATGGGCTGCAACGAGTGTACGCACCCCTCCTGCCAGCACTCGCTGAGCATGCTGGGCA
TCGGCCAGTGCGTGGAATGTGAGAGCGGGGTGCTGGTGCTGGACCCCACCTCGGGCCCCA
AGTGGAAGGTGGCCTGCAACAAGTGCAACGTGGTAGCGCACTGCTTCGAGAACGCCCACC
GCGTGCGGGTGTCCGCCGACACCTGCAGTGTCTGTGAGGCCGCCTTGCTTGATGTGGACT
TCAACAAGGCCAAGTCCCCACTCCCGGGCGATGAGACGCAGCACATGGGCTGCGTCTTTT
GTGACCCCGTCTTCCAGGAGCTGGTGGAGCTGAAGCATGCGGCCTCCTGCCACCCCATGC
ACCGCGGTGGACCAGGGAGAAGGCAGGGTCGAGGGCGGGGCCGGGCCAGGAGGCCCCCTG
GGAAGCCCAACCCCAGACGGCCCAAGGACAAGATGTCAGCCCTGGCCGCCTACTTTGTAT
GA
tgaccctgtcctccctcacccaggctgcagtgccatgcagacacctcatggcacttcaaa
ctattaaaatgcattttatcttatccagagctggggcccctttgctggtgcagcgatgtc
agagcgttaccgtgtccctgggcacctgtggggccctctctccctctccgaaacccaata

Predicted peptide sequence(s):


>TOP3B_1|GENSCAN_predicted_peptide_1|112_aa
MRALPAFLSRRARVPQPAAHPQPHRGSSSGPCSRGGYRQPLFPGPAASGVPASGSVARGF
REHPREWHLHAADRRDPQALHPDSSPPRRDNHDNYHYNDYENWHENIYAVNN

>TOP3B_1|GENSCAN_predicted_peptide_2|884_aa
MKTVLMVAEKPSLAQSIAKILSRGSLSSHKGLNGACSVHEYTGTFAGQPVRFKMTSVCGH
VMTLDFLGKYNKWDKVDPAELFSQAPTEKKEANPKLNMVKFLQVEGRGCDYIVLWLDCDK
EGENICFETVVLWVAPVLLYPQLSPVAQELVLDAVLPVMNKAHGGEKTVFRARFSSITDT
DICNAMACLGEPDHNEALSVDARQELDLRIGCAFTRFQTKYFQGKYGDLDSSLISFGPCQ
TPTLGFCVERHDKIQSFKPETYWVLQAKVNTDKDRSLLLDWDRVRVFDREIAQMFLNMTK
LEKEAQVEATSRKEKAKQRPLALNTVEMLRVASSSLGMGPQHAMQTAERLYTQGYISYPR
TETTHYPENFDLKGSLRQQANHPYWADTVKRLLAEGINRPRKGHDAGDHPPITPMKSATE
AELGGDAWRLYEYITRHFIATVSHDCKYLQSTISFRIGPELFTCSGKTVLSPGFTEVMPW
QSVPLEESLPTCQRGDAFPVGEVKMLEKQTNPPDYLTEAELITLMEKHGIGTDASIPVHI
NNICQRNYVTVESGRRLKPTNLGIVLVHGYYKIDAELVLPTIRSAVEKQLNLIAQGKADY
RQVLGHTLDVFKRKFHYFVDSIAGMDELMEVSFSPLAATGKPLSRCGKCHRFMKYIQAKP
SRLHCSHCDETYTLPQNGTIKLYKELRCPLDDFELVLWSSGSRGKSYPLCPYCYNHPPFR
DMKKGMGCNECTHPSCQHSLSMLGIGQCVECESGVLVLDPTSGPKWKVACNKCNVVAHCF
ENAHRVRVSADTCSVCEAALLDVDFNKAKSPLPGDETQHMGCVFCDPVFQELVELKHAAS
CHPMHRGGPGRRQGRGRGRARRPPGKPNPRRPKDKMSALAAYFV