GENSCAN 1.0	Date run: 16-Jan-104	Time: 04:48:14

Sequence TNFRSF13C_1 : 4146 bp : 59.96% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1206   1341  136  2  1  107   90   222 0.996  22.73
gagactccgtctcaaaaaaaaaaaaagaaaagaaaggggggccccaggcgagctcggtcc
cacccagcaggcgggggcggggcagggcagagtgctccccccgccccccgcttcctcccc
gagggccccggagcccagctcagcctcagtccccgcagcttgtgcggcggcgtcggcacc
ATGAGGCGAGGGCCCCGGAGCCTGCGGGGCAGGGACGCGCCAGCCCCCACGCCCTGCGTC
CCGGCCGAGTGCTTCGACCTGCTGGTCCGCCACTGCGTGGCCTGCGGGCTCCTGCGCACG
CCGCGGCCGAAACCGG
gtaagggggacccacggggcgcgcggcgccggcagctgcggggagaacggggccccgatc
gccagggcgcaggcagagccccgacccccgggggcgccgagggctgaaaggaccctgtgg
gcagggcctggaggggcccgcgatcaccgcgtggccctcaccgccgcctctctccctccc

 1.02 Intr +   1645   1878  234  2  0   72  113   278 0.535  27.59
gggcctggaggggcccgcgatcaccgcgtggccctcaccgccgcctctctccctcccctt
gtccaccgccccccggctgtccctcccctccccggccagcctcgcccccctccgcccctc
cccgtccccgctcctccctcccctcggccccctggcctccctccctgtcccctcccgaag
CAGCCGGGGCCAGCAGCCCTGCGCCCAGGACGGCGCTGCAGCCGCAGGAGTCGGTGGGCG
CGGGGGCCGGCGAGGCGGCGCTGCCCCTGCCCGGGCTGCTCTTTGGCGCCCCCGCGCTGC
TGGGCCTGGCACTGGTCCTGGCGCTGGTCCTGGTGGGTCTGGTGAGCTGGAGGCGGCGAC
AGCGGCGGCTTCGCGGCGCGTCCTCCGCAGAGGCCCCCGACGGAGACAAGGACG
gtgagttccgtgtgtaggggaaccagtctgagcggggcgcaggggctggggtgtcgggac
ggtctagggggagatgcatggcccctgagggggagagaagggctttaaggggaaacggag
acagagtggaaaagagtttgcgctgaggagctcaggctggggagggagacatagtcctgc

 1.03 Term +   2425   2612  188  2  2   75   43   158 0.978   8.62
ctccctgccctgccagctccccactggccaggcctctggactcagggtcagccaggtgcc
acccctccccaccctgcattgggcttcatttgacggaggactgcccctccagaggagtct
tctaggggagggagggaaggctgtgactgagtacggagcctctaccccctctgcctgcag
CCCCAGAGCCCCTGGACAAGGTCATCATTCTGTCTCCGGGAATCTCTGATGCCACAGCTC
CTGCCTGGCCTCCTCCTGGGGAAGACCCAGGAACCACCCCACCTGGCCACAGTGTCCCTG
TGCCAGCCACAGAGCTGGGCTCCACTGAACTGGTGACCACCAAGACGGCCGGCCCTGAGC
AACAATAG
cagggagccggcaggaggtggcccctgccctccctctggacccccagccaggggcttgga
aatcaaattcagctcttcactccagcatgcacatgccctctttctgggaccaggctaact
ctgcagaagcacagacactacagaccacagcattcagcccccatggagtttggtgtgctt

Predicted peptide sequence(s):


>TNFRSF13C_1|GENSCAN_predicted_peptide_1|185_aa
MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAAGASSPAPRTALQP
QESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDG
DKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTA
GPEQQ