GENSCAN 1.0	Date run: 16-Jan-104	Time: 03:43:08

Sequence TBX1_1 : 29290 bp : 58.17% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1491   1629  139  2  1   89   72   154 0.918  12.34
gtgccgggctagggccatccgacgggcgcgctccctccgggctgcgggagggcacgacgg
gtggggtggcggcaggtgaagaggagtgtgggcgggtggcggggtggcggggcggcggag
cgcggcggggcggtgccctaggcgggagggagggtcggaggagccctatcctgctgcgcg
ATGGAGGCGGTGGAGGCGGCGGCTCCGGCTGGAGGCTGGGACGGCCTCGCGCTTCGAGGG
CTTCCGGGCCCCTTTAGCCGAGGGCTCCTGGAGGGTCCCAGCGTTGAGCAACGGGGTCCG
GGGGTCCGAAATCAAGCGA
gtgagtataggcagccggtggggtagggtcggccaacagagccggctgggtggggcccct
cacctcttcccgtcgcccttctggttgaccagggtttcctccaccctgacggcctcttct
ctgctgtggcaagctggccgcccctgcctgcctgcaggtcctgctcaggcacgaaggggt

 1.02 Intr +   3199   3486  288  2  0   75   61   103 0.830   4.78
tcactctgcccagcctggtcgggccatagagcttctcccggcaggcaggctggctgctgg
gtgccggggggcagcatacgacccagtggcctgaagttctccaacatgtcctcgtgtcct
cggctccctcggctggccaggctccgcccccggccctccctgcgcccggccggtgcgcag
GGAGGTCGGAGGAGCGGGCACTGCCCACCCTCCGGATGTATAAGCGTCCTGGCCAGAGGC
GGGCGGTGCGCGCAAGTGCGCGTGACGCTCGGGCTCGCGGGCTGCGCAGCCTGGGCAGCG
TCCCTCTGCTGGGGTCTCCAGCGACGATAGTGAGCCAACTTCAGGGGGCTGTTGGGCATT
TACTGGGCTGGGTCCTGTCCTGCTGCGCCAAGGAACAGAGGACGCTGCGGCCCTGGGGCT
CCTGTCAGTGGCCGGTGCGAGAGCCCAAGCTGCCCTCTCCTCACCCAG
gtgcaggggcagccagggaggaggtggaggcgggaggggccaagggcaggggcagggctg
ggctccggcagccactcgctgcttcatgggtgccctgccacctcgggctagggctgggtg
ctgctggcatagacacctctcctcggggggctgtagaagctgacggtggcttcgctgcac

 1.03 Intr +   3867   4175  309  1  0   33  105   225 0.595  16.25
caggagcaacgggatgttcaaggggcgttggtcatggaggtccctgggaatggaggaagg
gggcagggagcttggaaagcaagagggccctgcacttccagggtgctccacccgtctggg
cccctcggctgctaccagccccaagtggggggcccatgacgccataatcctctgggccag
GGGCCCCTGGCAGTGAGTGGCACCACAGGCCCCCGCCCCCGGACTCCGTGGGCTGGGCTG
GGCTGGGCGCGGTGCGGCTGGGCACACGCAGTCGGAGGCGGCGCCGGCCAGGCCGCCGGG
CGCCTATGGACGCGCGGAGCCCGCTGTCTCCCCGAGCCAGTGCGTTCAGCATCGCCTCTC
TGGTTGCAGCGGAGGCGGCGGAGCGCACCGCCCACCAGGGCTCAGGGTCCTCCGACCGGG
TGAAGCTTCGCTGGCTGCCAGGATCCCCGGCAGGGATGCACTTCAGCACCGTCACCAGGG
ACATGGAAG
gtgagcctccaggccgtgtctacactggcccgcccgccagaccccctgcctcagctgctg
tggggcccgggtgcaaagtaggtggaggcagctcttggtagcgtgggctccaggcttctg
gctgcgattctggggcagagaggaagagccggcatcccgcccacagcctgtcccctcacc

 1.04 Intr +   5403   5778  376  1  1   55   71   699 0.051  60.28
ggcctgcggtgtggggctgcacggcccggggcgcacgcagcgcggcgcccgccactcggc
ccgcggcgcggggcagcgctcagcttggtggcgggggcggcggcggcggcccgcgggtca
tgatctccgccgtgtccagcccgtggctcacgcagctctcgcatttctgcgacgttgcag
CCTTCACGGCCAGCAGCCTGAGCAGCCTGGGGGCCGCGGGGGGCTTCCCGGGCGCCGCGT
CGCCCGGCGCCGACCCGTACGGCCCGCGCGAGCCCCCGCCGCCGCCGCCGCGCTACGACC
CGTGCGCCGCCGCCGCCCCCGGCGCCCCGGGCCCGCCGCCGCCGCCGCACGCCTACCCGT
TTGCGCCGGCCGCCGGGGCCGCCACCAGCGCCGCCGCCGAGCCCGAGGGCCCCGGGGCCA
GCTGCGCGGCCGCAGCCAAGGCGCCGGTGAAGAAGAACGCGAAGGTGGCCGGTGTGAGCG
TGCAGCTAGAGATGAAGGCGCTGTGGGACGAGTTCAACCAGCTGGGCACCGAGATGATCG
TCACCAAGGCCGGCAG
gtcagggcgcccctccccacgccgcgaccctccccacgtgctgccgccagggctgcgggc
ctccgcctgatccgcgcgagcggggccgaaagccgggtcgggggcgcggcctggccacct
gcgggcccctctgggccccgctgcctccttcgctgttcgccgtcccggctccggcgacag

 1.05 Intr +   6643   6794  152  1  2   96   39    88 0.618   5.70
gtagacaaaggcgggtgccgcgctgtgtctaatgtacacaccagctcggagtccgaacag
ccaaggggagctcagggcctgtttgcaaagccttctcgtggtttctgtttccctgctgcc
ggcgtcctttctgaggaacctgggcctgtgctctgctccagctctgtggtttttttccag
GCCCTCCTTGCTGTCCCCAGGCACACAGGCCCTCCTGAGGACAGCGGCAGCCCAGCCGCT
GGCTCAGGCCAGCCCGGCAAGGGCCTTGTCGGCGCTGGGCTTCACCCGGGAGCCCACGTC
CCGCAGCACCCTCCAGCCTGCAGAGGCTTCGG
gtgggggagggagcgggcctgtcctagaggctggctcctggcatctgtcttctgcccacc
gcctgcagggagttgcttgtgaggggaggcagaggggacggcaagtgagggccaatcctt
gtgttgtcctgaagggccccacggccactactgctgtgccatcatgtgggggtagcccat

 1.06 Intr +   7708   7840  133  2  1   14  105   278 0.546  22.98
ggctcccctgctgcgccaagctcccagttgagtaggggcctgcccagattagagcagcta
agccaggaaagatggagcccaagggctgggacgacacagcagcccccagaggctggaggg
aggggccgagcagaggggccgccagccccaggcaggtcaaggggggctgccttccaccag
CTAGGGTGACCCAAGGCCTCATCACCCCCAGGCGGATGTTTCCCACCTTCCAAGTGAAGC
TCTTCGGCATGGATCCCATGGCCGACTATATGCTGCTCATGGACTTCGTGCCGGTGGACG
ATAAGCGCTACCG
gtgagcgagtggttgtaagcgtgagggaccgggagggcaccctggaaagtggcgggtctc
cgcctggtgacccaactccaagggtcgtctgcaccatgaaactctttaggcacctgcgat
gctgcccgatcaacccgctccctcctccactcccatctgaccccagacccacaaccctac

 1.07 Intr +   8653   8824  172  1  1   86   68   290 0.955  27.94
ggagttctctgtttagtccatagtcccccttggaaaagctcccagcacatgcggcagcag
agggttcaatctcacaggtggggaaacttctcaaaggcacttttagggttcgcccagcac
acgggtcaaggccctctgggttcacctccacatgcacgaccccaccccgtgccgctccag
GTACGCCTTCCACAGCTCCTCCTGGCTGGTGGCGGGGAAGGCCGACCCTGCCACGCCAGG
CCGCGTGCACTACCACCCGGACTCGCCTGCCAAGGGCGCGCAGTGGATGAAGCAAATCGT
GTCCTTCGACAAGCTCAAGCTGACCAACAACCTACTGGACGACAACGGCCAC
gtgagcgactgcctccccaggctccggtgtcccccaaggcctcgagtcccgaggcacccg
cctgtccctaagaggcctgtagaatccccaggcccccggctgtccccaggcggctctggg
ctgtccccgaggaggccctttagagtccctgcgaggctagaggctgaggcggagcttggg

 1.08 Intr +   9405   9611  207  2  0   96   76   264 0.612  26.49
agagaacctaaacccagatcttttgccacttggagctcattcctggcagttgccaatggg
tcacagcctcctcttggcccagtgacccagcctcatcttggaattaagggttttgcccaa
ctcatccaggaaactcattgccaactcagacctcagcccatttcctggctcccaccccag
ATCCTCAGCCCAGCCCCACCGCTGGAGCTGATTCCCCACCTTGTCTTCCAGATTATTCTG
AATTCCATGCACAGATACCAGCCCCGCTTCCACGTGGTCTATGTGGACCCACGCAAAGAT
AGCGAGAAATATGCCGAGGAGAACTTCAAAACCTTTGTGTTCGAGGAGACACGATTCACC
GCGGTCACTGCCTACCAGAACCATCGG
gtgagggcctgtggggaggacctgagcggattcaacgcctctggaaaagcgggtgtaatt
ttcagttgccgtttggggacagtgggtccgcttagacctgcaggctgtggtcccagtgga
gcccaacccaactggagccccactcccaagggcctcaggcagccccctccctctcgaggc

 1.09 Intr +  10256  10323   68  1  2   83  105   129 0.947  12.95
ccgcccccctgcaggagggagcaccagctccgtagaggaggggcagacgtggactggttc
ttgtcagggcagcagaaaggcccttggtgcgcttctcctaacactcccctatcctccgcc
gaggtcgggtggcccaggctgcagggctccagcggcttgctcacacccacctccctgcag
ATCACGCAGCTCAAGATTGCCAGCAATCCCTTCGCGAAAGGCTTCCGGGACTGTGACCCT
GAGGACTG
gtgagtgtcctcccccgagagagtgagcgccgggcgcctggcgcaggcgccgccctgatc
cgcctcccgcccgcaggccccggaaccaccggcccggcgcactgccgctcatgagcgcct
tcgcgcgctcgcggaaccccgtggcttccccgacgcagcccagcggcacggagaaaggta

 1.10 Intr +  10400  10500  101  2  2  112   97   147 0.999  18.92
ggctccagcggcttgctcacacccacctccctgcagatcacgcagctcaagattgccagc
aatcccttcgcgaaaggcttccgggactgtgaccctgaggactggtgagtgtcctccccc
gagagagtgagcgccgggcgcctggcgcaggcgccgccctgatccgcctcccgcccgcag
GCCCCGGAACCACCGGCCCGGCGCACTGCCGCTCATGAGCGCCTTCGCGCGCTCGCGGAA
CCCCGTGGCTTCCCCGACGCAGCCCAGCGGCACGGAGAAAG
gtagggccggggtcgtgggatccgggttccggccctgtgcgcgctctaccccgggccggc
ggcctcgcccgacctcgcctgcgcccccggggcgctccaggctttcgcgccggttgcaca
acggccgcggcggcgggcaagcgcgcactcgcccgcccggcccgacggctgcgccccgcc

 1.11 Term +  10887  11365  479  1  2  113   41   594 0.917  53.32
cgcgggccccggggagggctcggggcgccggcgacttggggtctcgggcacgctggcacc
gactggtcggggaacaccgagggcggccaagagccttctctccgccagggcctcgcatgg
ggcgtcggagctcctcggcggccccggccggccgcgctcactcctcggccctctccgcag
ACGCGGCTGAGGCCCGGCGAGAATTCCAGCGCGACGCGGGCGGGCCAGCAGTGCTCGGGG
ACCCGGCGCATCCTCCGCAGCTGCTGGCCCGGGTGCTAAGCCCCTCGCTGCCCGGGGCCG
GCGGCGCCGGCGGCTTAGTCCCGCTGCCCGGCGCGCCCGGAGGCCGGCCCAGTCCCCCGA
ACCCCGAGCTGCGCCTGGAGGCGCCCGGCGCATCGGAGCCGCTGCACCACCACCCCTACA
AATATCCGGCCGCCGCCTACGACCACTATCTCGGGGCCAAGAGCCGGCCGGCGCCCTACC
CGCTGCCCGGCCTGCGTGGCCACGGCTACCACCCGCACGCGCATCCGCACCACCACCACC
ACCCCGTGAGTCCAGCCGCCGCGGCCGCCGCCGCCGCTGCCGCAGCTGCCGCGGCCGCCA
ACATGTACTCGTCGGCCGGAGCCGCGCCGCCCGGCTCCTACGACTATTGCCCCAGATAA
cacgggccctgtcgcgctcccgccccggtcctgcacagccccgaagttcgccgggcccgg
ccaccctgccccaagggcaagcaaggaatacgttcccccagccccaggggccaccgcggc
tctccccttccccagcctcgaagccatgggggccccctcgccacccccagccccttgggc

 2.06 PlyA -  11854  11849    6                               1.05
 2.05 Term -  12852  12747  106  2  1   43   45    80 0.046  -1.99
 2.04 Intr -  15069  14985   85  1  1   98   72    24 0.126   1.83
 2.03 Intr -  15310  15257   54  2  0   80   72    53 0.201   2.99
 2.02 Intr -  17819  17724   96  0  0   78   57    43 0.142   1.34
 2.01 Init -  20343  20262   82  0  1   74   75    71 0.167   3.63
 2.00 Prom -  22043  22004   40                               1.34

 3.01 Init +  28797  28984  188  2  2  109   92   105 0.861   9.70
atgaagttctagctaattgagtataagcatttctaaagaacccccggagggttgtttttc
tttgtgcaaacactccttttgtgcagagggtgttctgtggcttcttggcagagacacagg
tgggaaacacctgattgaacatcattgcctggggagtggagacacgcacagcacgtcaac
ATGGAGCGCCCAGCAGCGGCGGCGGGTCCTGGGCTGTGCTCCGGAGCCCTTCCCGGGATC
ATCTCCCGGCATCGGCTGACCCCTCGGTGTCTACGTGCCAAGCCCAATCTGCCTGCAGGG
ACACCCACTGCCAGAGGCGGAGGCAGGTTCTCCTGGTCCCAGACCCAGGGCCGTCTGTTG
GCCTGCAG
gtaacacgcagggaggaaggaaaaggctctaggcacagctgcttgtctaagagggaccct
gttggcggcgcaacgctgggtgagtgctgcccgcccgcggatggggtgctggccgaacct
accttgtaaagtggggctgcacagaggtcagcacatggtggcgcccaccgtcgagagggg

Predicted peptide sequence(s):


>TBX1_1|GENSCAN_predicted_peptide_1|807_aa
MEAVEAAAPAGGWDGLALRGLPGPFSRGLLEGPSVEQRGPGVRNQARRSEERALPTLRMY
KRPGQRRAVRASARDARARGLRSLGSVPLLGSPATIVSQLQGAVGHLLGWVLSCCAKEQR
TLRPWGSCQWPVREPKLPSPHPGAPGSEWHHRPPPPDSVGWAGLGAVRLGTRSRRRRRPG
RRAPMDARSPLSPRASAFSIASLVAAEAAERTAHQGSGSSDRVKLRWLPGSPAGMHFSTV
TRDMEAFTASSLSSLGAAGGFPGAASPGADPYGPREPPPPPPRYDPCAAAAPGAPGPPPP
PHAYPFAPAAGAATSAAAEPEGPGASCAAAAKAPVKKNAKVAGVSVQLEMKALWDEFNQL
GTEMIVTKAGRPSLLSPGTQALLRTAAAQPLAQASPARALSALGFTREPTSRSTLQPAEA
SARVTQGLITPRRMFPTFQVKLFGMDPMADYMLLMDFVPVDDKRYRYAFHSSSWLVAGKA
DPATPGRVHYHPDSPAKGAQWMKQIVSFDKLKLTNNLLDDNGHILSPAPPLELIPHLVFQ
IILNSMHRYQPRFHVVYVDPRKDSEKYAEENFKTFVFEETRFTAVTAYQNHRITQLKIAS
NPFAKGFRDCDPEDWPRNHRPGALPLMSAFARSRNPVASPTQPSGTEKDAAEARREFQRD
AGGPAVLGDPAHPPQLLARVLSPSLPGAGGAGGLVPLPGAPGGRPSPPNPELRLEAPGAS
EPLHHHPYKYPAAAYDHYLGAKSRPAPYPLPGLRGHGYHPHAHPHHHHHPVSPAAAAAAA
AAAAAAAANMYSSAGAAPPGSYDYCPR

>TBX1_1|GENSCAN_predicted_peptide_2|140_aa
MRPHWGVWAHLGRGRSAERALGHRFMPDLPLGPEQQLLSPELGPCRLSQEVAEQAGFQIV
RGEAASALGNCGYVEFSAQGATKQTRLVPQPSPRVLLPLHLQCFPGANMYTKNRSARVDI
WKLLAVPSERWHSGCRYHVG

>TBX1_1|GENSCAN_predicted_peptide_3|63_aa
MERPAAAAGPGLCSGALPGIISRHRLTPRCLRAKPNLPAGTPTARGGGRFSWSQTQGRLL
ACX