GENSCAN 1.0	Date run: 16-Jan-104	Time: 04:26:04

Sequence PVALB_1 : 21024 bp : 51.42% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   3675   3735   61  2  1   61   89    99 0.682   8.66
ggcgcggctggactgagccgctcccgctgcgctcagagtccgggcccctggcgccatgcc
aggcccggcgggcgtgcgcccggcgcgcagcactgcagcgctggtcatatgagcagaaat
gatgagaaaagcactttttaatcttttcgcacttgctctgcccgctcaaacagttgcagg
ATGTCGATGACAGACTTGCTGAACGCTGAGGACATCAAGAAGGCGGTGGGAGCCTTTAGC
G
gtgagcaagcgcgctcccctccccatccctctcccctcgtccaccgcccgcgcccctgca
ctccgccggccccgcagccggcggatcctccccagcgcgcttctgcccacacttcccgct
gggcgccggcgaggtcggggcgggggcgtccttggcagttcccaaactctgtccgggcga

 1.02 Intr +   4668   4706   39  1  0   99   75    23 0.630   0.78
gcagaaggggtattagaactgggttgcccagcctagtgtcggaggtggacagggcaactt
tccttgtctctagccctgtgctgaggggaagagaacatgacttcaacagccattccctac
acacacacacacacacacacacacacaaaatacatgatctaacattgtacccttccccag
GTGTTCTAAAACAGGACCCCAAGATACAGAAAATTGCAG
gtagaaaaggacccccatttcctttctgctttgcaccccctcccctgggcacaagaacct
ctctgggaagccaccctcccagggtcctgggataaccctctcccttcacctcaagcccat
gtgggaagaaacttaactgggtgtttctcgggagcctcctaacacccccttcccactgcc

 1.03 Intr +   5075   5188  114  0  0   90   59    18 0.484   0.02
ggatttctgcgcagagccaggacttccgggtttgcccctcctcctcccactgtatgacct
tgagggaaacctgtcctttctatgtcaattttctggcaacaaagtctgtggccaagaaag
aaggtcaaccctcctccccctaaccccaggaccatgttcatgcccccttcaattccccag
CCCACTCCCAACCAGCTGGCACTCAAAAGTCTTCCTGGGCACAAGGTTCTCAGAAGAACA
AAAGCCTTTGGTTCTTAGGTGCTGCTCCCATCATCAGCAATGGGTGCAGTGGAG
gtggggcgtgggggcgggcttgagagccagggaggtctgggtttgagcacacctcttcca
ctcccagccttgtgaccttggacaggttatcctcccttgcccgggctccctcagccctcc
aatggaggtgggtacctctcattccccatgactggcatgtgggaatccatcaacaaatgc

 1.04 Intr +   5445   5577  133  1  1  134   86   268 0.999  31.41
cttggacaggttatcctcccttgcccgggctccctcagccctccaatggaggtgggtacc
tctcattccccatgactggcatgtgggaatccatcaacaaatgccttgatgccccccatt
ctcccaggcttccctaccagcctttctggtccttgtttgaccctgctcttccccccacag
CTACCGACTCCTTCGACCACAAAAAGTTCTTCCAAATGGTCGGCCTGAAGAAAAAGAGTG
CGGATGATGTGAAGAAGGTGTTTCACATGCTGGACAAGGACAAAAGTGGCTTCATCGAGG
AGGATGAGCTGGG
gtaagcggaggcctgcaggggctgcccagcccacggctgcacgagagggagtgggggctg
ggactctagcttccaagtgtccatcagacctgcctttcactctgcctgcttcacagaaag
taaccgtgcgtgaaggcagggctccgacccagggcaccaggggagaaggcttcctggtgc

 1.05 Intr +   6925   7034  110  1  2  139   76   165 0.950  20.83
acgaaagcacagccaccgagcaggctacctggcccagagcatccgtgtgcgtgactgctg
ctcgctgcctgtcccagccatccctttccccatacagaaaccagaccaccctccatccag
cgtcctgcaaggcgacctcggcctgactccctcaccggctttctcccttttctcctccag
ATTCATCCTAAAAGGCTTCTCCCCAGATGCCAGAGACCTGTCTGCTAAAGAAACCAAGAT
GCTGATGGCTGCTGGAGACAAAGATGGGGACGGCAAAATTGGGGTTGACG
gtgggtagccgtgacctggggtctgggcatattgtggatcttggggtgttggatgcgaaa
agtttgaagctatgtctgtcacaaggaagggatgatatgggggtccctcactcccccaga
ttagaagacaaaaagcagtccattaggtctgagagctctgccacatactccagacaaagg

 1.06 Intr +   7676   7693   18  0  0   91   94    29 0.424   0.86
tcctatctcctgtcctcctcagcatcttgtcctggtgtcctgtaaccccaagtctcaaaa
cctgtttgggttttactcaaatatactattctagccttgcagcagagccaggaaaaacag
taaaccagaaatcagtggggaattcagacagggaatacctggccctgccttgctttgcag
GCTTCAATGTCAGCACAG
gtgagagaccagtggcccaccgtccactcctttctccatttggctctgtgtggcattcat
ggagcacacccacattgctatctctcttagcttatgattttctccggaattatctccatt
ttgcaggtgggcaaatggactttgaaggtgcttagcctagttgaaagagctaggacatag

 1.07 Term +   7820   7848   29  0  2   90   38    31 0.422  -3.18
cagacagggaatacctggccctgccttgctttgcaggcttcaatgtcagcacaggtgaga
gaccagtggcccaccgtccactcctttctccatttggctctgtgtggcattcatggagca
cacccacattgctatctctcttagcttatgattttctccggaattatctccattttgcag
GTGGGCAAATGGACTTTGAAGGTGCTTAG
cctagttgaaagagctaggacatagcggtggagtggggatttagaaccaggcctgaatga
gtgtttgcaacatactaagctgccatttgttcccataataggcttttctgctggtctcag
agaaaactgtgtgtaggtgtttggcctctgggccccaggctatctgggttcaaatcccag

 2.03 PlyA -   9378   9373    6                               1.05
 2.02 Term -  11632  11468  165  1  0   81   42   112 0.802   4.13
 2.01 Init -  19720  19634   87  1  0   61   94    39 0.578   2.72

Predicted peptide sequence(s):


>PVALB_1|GENSCAN_predicted_peptide_1|167_aa
MSMTDLLNAEDIKKAVGAFSGVLKQDPKIQKIAAHSQPAGTQKSSWAQGSQKNKSLWFLG
AAPIISNGCSGATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILK
GFSPDARDLSAKETKMLMAAGDKDGDGKIGVDGFNVSTGGQMDFEGA

>PVALB_1|GENSCAN_predicted_peptide_2|83_aa
MQERLSTPDCGALGGALSGFLLLLQQPQSDLQETDKYHSPSEGQTEQGREAVPGLGSLAP
ATDKSPQIPNLGLQIISHYIQQL