GENSCAN 1.0	Date run: 16-Jan-104	Time: 03:40:02

Sequence PRODH_1 : 26171 bp : 58.67% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1467   1739  273  2  0  108   85   506 0.450  47.47
gggtccccaccatgcagctgaagtgccagggtgcttgtgaagtctaagcccttgtctggc
atttgtcaggaatatagggtgaggcctctgggaccgagcggggcggggcggggcggggcg
gggcggggcgggaccaacagcgcacacttaagcggcccgggcgggtaccgccgtcccgcc
ATGGCTCTGAGGCGCGCCCTGCCCGCGCTGCGCCCCTGCATTCCCCGCTTCGTCCCGCTG
TCCACGGCGCCGGCCTCCCGCGAGCAGCCCGCAGCGGGCCCAGCGGCCGTGCCAGGAGGT
GGGTCGGCCACGGCAGTGCGGCCGCCGGTGCCCGCCGTGGACTTCGGCAACGCGCAGGAG
GCGTACCGCAGCCGGCGAACCTGGGAGCTGGCGCGGAGCCTGCTGGTGCTGCGCTTGTGC
GCCTGGCCCGCGCTGCTGGCGCGCCACGAGCAG
gtgcgcggggtgcaggcgggggcgcgggggcttctgccggtcccgggagcctttacggag
cttcctggcctgaaacgggtgcctcccaagcatctcctggagcaagggaagccaggaagg
gaggcgtttcctgcagtccctctcggacctcgcaaattttcctatttgtcgatgtctacc

 1.02 Intr +   6556   6764  209  0  2   90   55   291 0.442  25.09
ggagaagcaagcggctttagctggtcttcaccatgaaactgaccctgaaagcccagtcgc
caagagaccatatcgaggccccatggctggggtgaagtgtggtcggggatgagcagcggt
gccttgctgggaaaggagagttcaggcagcccaggacagcggcttccctttgcctttcag
CTGCTGTATGTTTCCAGGAAACTTCTAGGACAGAGGCTATTCAACAAGCTCATGAAGATG
ACCTTCTATGGGCATTTTGTAGCCGGGGAGGACCAGGAGTCCATCCAGCCCCTGCTTCGG
CACTACAGGGCCTTCGGTGTCAGCGCCATCCTGGACTATGGAGTGGAGGAGGACCTGAGC
CCCGAGGAGGCAGAGCACAAGGAGATGGA
gtaaggcctgcccggtgtctgcgggctttctgatcatgaccctggagcacccagtgggag
caggtgggatgtatccagctgctgggcttcagcctcagctgggcagaggccaaggctagg
agagcttggtcagcccaactaccgatgaccctcctgggctctgcctggagttcttgcatt

 1.03 Intr +  12032  12066   35  2  2  167   89    30 0.678  10.00
gcccctcccaggcccaagtgttccaccccaggctaggggtggggctggggctgcaccttg
gaatctaccctccaccggggttgtggtggggccctccgtgcagcctcagtgggaacgtgc
ctgtcacctgaggctcaggtggcgtgaccctgacctttgctctccccctccttcccacag
GTCCTGCACCTCAGCTGCGGAGAGGGATGGCAGTG
gtgagtgagaggctgccgcgcaggaacagactccctcccgactccgcacaccccttggtg
gctcaggagagtctaggctggggcacaagtgggccttggggtgacgtcggagcccgggct
cctccctatgtccagggcacctgccctgtcgctctgggctctgacatactcgcaagtgtc

 1.04 Intr +  12554  12703  150  0  0   73   75   319 0.987  30.42
ggtgtagacaggagggtgggcttggggatgggaaccatggggcagtgcagtgccagggcc
aggctggcaaggccactatgcttggagccctcctgagggcaggggccctgggctattggt
gtgtgggtgctgggggtgggtgtttggagctgtgctcaggccgtgcattcgctattccag
GCACGAATAAGCGGGACAAGCAATACCAGGCCCACTGGGCCTTCGGGGACCGCAGGAATG
GTGTCATCAGTGCCCGCACCTACTTCTACGCCAATGAGGCCAAGTGCGACAGCCACATGG
AGACATTCTTGCGCTGCATCGAAGCCTCAG
gtggggccccctctttgctggctatacccctgccatgtcccagcctgagcggacccctgg
gctcatggaggtgccggtgggtgaacactaagctggggcaggagccagagggctgggttc
tgaccacacttgggtccctcactgttcagccccttcctgaggggccccactgcctcccag

 1.05 Intr +  14575  14639   65  2  2   86  119    70 0.890   9.48
gagccccctcccatctccacagggcctctagagcgccatgtgcaaggacttcatgggcgg
ggtggggtggggtcaggagcctgctgtgggctggccaggccctggccctccctgtcgcac
cctgcgctgcctccatgcacctctcagggctgtcatggcttttcctgtggcttctgacag
GTAGAGTCAGCGATGACGGCTTCATAGCCATTAAGCTCACAGCACTGGGGAGACCCCAGT
TTCTG
gtaagtgctagaaccttccacctgcagagtctggtgctgtgcgagatctcagggcagctg
tgggcatccaccaaaaacacaggtgcccatgccttagaggcctgagctggccacaggggc
tgtgtgggggactggggtgggcaggggcgtgtgcagatggcattcaggcctgcgtttgca

 1.06 Intr +  14821  14937  117  0  0   22   75   121 0.648   6.03
taagtgctagaaccttccacctgcagagtctggtgctgtgcgagatctcagggcagctgt
gggcatccaccaaaaacacaggtgcccatgccttagaggcctgagctggccacaggggct
gtgtgggggactggggtgggcaggggcgtgtgcagatggcattcaggcctgcgtttgcag
CTGCAGTTCTCAGAGGTGCTGGCCAAGTGGAGGTGCTTCTTTCACCAAATGGCTGTGGAG
CAAGGGCAGGCGGGCCTGGCTGCCATGGACACCAAGCTGGAGGTGGCGGTGCTGCAG
gtggggcagccttccccttccccactcctgtggcttgtgagggggtgggcaccgtggggt
cacacggggcatggtgggcagtggtcggaggtggttttgggaactcacccagggcatgtg
gctcactctgcagctgctggggttggcctggtggggaggaggaggtcagagggactctga

 1.07 Intr +  15350  15429   80  1  2   58   72    59 0.962   0.80
tgggcgtgcatcagcagcggggtgggaatagacctgtctatgcagtagaaacaaaccaga
catggatcctgttcttactaacgatgtaataaagccagaaacagcaccagaggccaatgg
gtggggggaaggataaaatatgagtgaatggggctgatccaggccttctcacttctcaag
GAAAGTGTCGCAAAGTTGGGCATCGCATCCAGGGCTGAGATTGAGGACTGGTTCACGGCA
GAGACCCTGGGAGTGTCTGG
gtgagagcagcccccaggctgagaggacacgagcatcagccatggttccagccaagcccc
agtgacgtctcccagtcctggctgccctgcctgagagggtgggccctgggatgacagtgc
tgaaggaactgcttttcacacagcaggacttgatggcttcaggagtccctgaggctgggg

 1.08 Intr +  16331  16412   82  2  1   99   92   143 0.995  16.59
cactggttttaaatttttaaacagaaaacaatatttatatttcctctgtcttttaaaact
gaacaccgaggtgggttttgtggtgggtggtgaacggacaggtttgggcctcgatccccc
acccgaccctagcacccacaggtgggggtgccccctctgctgatgcgcctcctccctcag
CACCATGGACCTGCTGGACTGGAGCAGCCTCATCGACAGCAGGACCAAGCTGTCCAAGCA
CTTGGTAGTCCCCAACGCACAG
gtaacacctccgctcctcagtgaggcccagctcagcagggcgctgcgctaagaagggaat
tcagcctgccacgtgtgtctcttgttgcctaccctgggaacttaacatgaccaaaatcac
tgcacactatggccccacagaccccctgtggtccagggggaagaagacaagcccactagt

 1.09 Intr +  17956  18048   93  0  0   79  105   151 0.991  17.22
ctggctgcgttggaggttcaggggcactgtgctgcttgtccaggtggccctccctcccag
ccctgcacagacgggtgagagggttcctgtgggctgggaatactgagagaggtttagcct
gggcctcagggtggcactttcccgcccttgctgtggcctgaccgcgtgttgcacccccag
ACAGGACAGCTGGAGCCCCTGCTGTCCCGGTTCACTGAGGAGGAGGAGCTACAGATGACC
AGGATGCTACAGCGGATGGATGTCCTGGCCAAG
gtgagctgtcccgctcgggcagagggtacctgggactcgtggagaagagggcacctgcct
cacttgagcaacagttgctcccactctcccaccccctgcgcctctcagaaagccacagag
atgggcgtgcggctgatggtggatgccgagcagacctacttccagccggccatcagccgc

 1.10 Intr +  18157  18396  240  0  0   94  -34   345 0.911  21.88
ctgtcccggttcactgaggaggaggagctacagatgaccaggatgctacagcggatggat
gtcctggccaaggtgagctgtcccgctcgggcagagggtacctgggactcgtggagaaga
gggcacctgcctcacttgagcaacagttgctcccactctcccaccccctgcgcctctcag
AAAGCCACAGAGATGGGCGTGCGGCTGATGGTGGATGCCGAGCAGACCTACTTCCAGCCG
GCCATCAGCCGCCTGACGCTGGAGATGCAGCGGAAGTTCAATGTGGAGAAGCCGCTCATC
TTCAACACATACCAGTGCTACCTCAAGGCAAGCCCCCGCTCAGCCCCTCCCTGCCTGCCC
TGGGGCTTGGAGACCCCACAGGAGGGGCTCCTCTCATCTGAGCTCCCTGGCATTTGGCTG

gttttacactcagcacccaccagggagctcatgggatggaggagggagtgggccgtgccc
ccaaggggttgttggggtcttctgcagcacagctcacccagcgggccccagggtccagga
aagagccccttaggtggtggccacagccaggcctgcagaggaggctgaggccagggtgac

 1.11 Intr +  19263  19438  176  2  2  112   85   366 0.999  38.64
ccttggggacagaggttggaggcccatcctcacccacacctgctccaggtgccctgagct
gcacctccccaggcagctgctgcccagccctggtgactgcacctgggcccaggaaggccc
catcctgctgtcacttgggcttgcccaggctccctgtgacttttggccctggccccacag
GATGCCTATGACAATGTGACCCTGGACGTGGAGCTGGCTCGCCGTGAGGGCTGGTGTTTT
GGGGCCAAGCTGGTGCGGGGCGCATACCTGGCCCAGGAGCGAGCCCGTGCGGCAGAGATC
GGCTATGAGGACCCCATCAACCCCACGTACGAGGCCACCAACGCCATGTACCACAG
gtgcgcagctctcccacccctctgtcttctcagggcagggcgccaagaaaccaggcctga
gggagaggcttggagactgaacttgtcagccacatgtgtccccaggtcagaactggtatt
tcctcagcttttatgtcatgtgttactttttcaaaagcattaaggttattcttttataaa

 1.12 Intr +  20766  20864   99  0  0   73   96   211 0.975  20.79
atgaggtgctgggaggggcagatgctgctcctgttcctcctgatcctgtggatacccttg
gaaagagccagctcaatggatggatctgggtctgccctcggcctcctctctgtgcagctg
gtaatgagaggtgcaggcagccacaggcctggaactgggctcacatggcactctccacag
GTGCCTGGACTACGTGTTGGAGGAGCTGAAGCACAACGCCAAGGCCAAGGTGATGGTGGC
CTCCCACAATGAGGACACAGTGCGCTTTGCACTGCGCAG
gtaggtgtgccccaccctgcaccgaaaccccaacctgagccgttgtctcctccggctggg
gagaggtggcagcagcgcagagctcagggtgggcagagcgacctgctgggtggtcgggca
tttgtggggaaaggctggtgaaatgagctggagggtggcttcagtgggcaggcccaggcc

 1.13 Intr +  24228  24316   89  0  2   75   92   101 0.794   9.97
ggggcagggccaggcagagcccataccccagccccaccttgcaggggatgaagtctggag
agtgcagatggggcacctgggatggcaggacaggctcagagctgggacaggagccctgta
tccctgcactggggacagtgtcctggaactggccctcagttcctggcttcacctgcacag
GATGGAGGAGCTGGGCCTGCATCCTGCTGACCACCGGGTGTACTTTGGACAGCTGCTAGG
CATGTGTGACCAGATCAGCTTCCCGCTGG
gtgagtggggccctccctggtgcgatggggtacggtgctgggcctgggcctcatggtgta
tctgcccccatgcaggccaggccggctaccccgtgtacaagtacgtgccctatggccccg
tgatggaggtgctgccctacttgtcccgccgtgccctggagaacagcagcctcatgaagg

 1.14 Term +  24392  24579  188  0  2   97   42   297 0.999  24.62
ggcttcacctgcacaggatggaggagctgggcctgcatcctgctgaccaccgggtgtact
ttggacagctgctaggcatgtgtgaccagatcagcttcccgctgggtgagtggggccctc
cctggtgcgatggggtacggtgctgggcctgggcctcatggtgtatctgcccccatgcag
GCCAGGCCGGCTACCCCGTGTACAAGTACGTGCCCTATGGCCCCGTGATGGAGGTGCTGC
CCTACTTGTCCCGCCGTGCCCTGGAGAACAGCAGCCTCATGAAGGGCACCCATCGGGAGC
GGCAGCTGCTGTGGCTGGAGCTCTTGAGGCGGCTCCGAACTGGCAACCTCTTCCATCGCC
CTGCCTAG
cacccgccagcacacccttagcctccagcaccccccgcccccgcccaggccatcaccaca
gctgcagccaaccccatcctcacacagattcaccttttttcaccccacacttgcagagct
gctggaggtgaggtcaggtgcctcccagccctgcccagagtatgggcactcaggtgtggg

Predicted peptide sequence(s):


>PRODH_1|GENSCAN_predicted_peptide_1|631_aa
MALRRALPALRPCIPRFVPLSTAPASREQPAAGPAAVPGGGSATAVRPPVPAVDFGNAQE
AYRSRRTWELARSLLVLRLCAWPALLARHEQLLYVSRKLLGQRLFNKLMKMTFYGHFVAG
EDQESIQPLLRHYRAFGVSAILDYGVEEDLSPEEAEHKEMESCTSAAERDGSGTNKRDKQ
YQAHWAFGDRRNGVISARTYFYANEAKCDSHMETFLRCIEASGRVSDDGFIAIKLTALGR
PQFLLQFSEVLAKWRCFFHQMAVEQGQAGLAAMDTKLEVAVLQESVAKLGIASRAEIEDW
FTAETLGVSGTMDLLDWSSLIDSRTKLSKHLVVPNAQTGQLEPLLSRFTEEEELQMTRML
QRMDVLAKKATEMGVRLMVDAEQTYFQPAISRLTLEMQRKFNVEKPLIFNTYQCYLKASP
RSAPPCLPWGLETPQEGLLSSELPGIWLDAYDNVTLDVELARREGWCFGAKLVRGAYLAQ
ERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAKAKVMVASHNEDTVRFALRR
MEELGLHPADHRVYFGQLLGMCDQISFPLGQAGYPVYKYVPYGPVMEVLPYLSRRALENS
SLMKGTHRERQLLWLELLRRLRTGNLFHRPA