GENSCAN 1.0	Date run: 16-Jan-104	Time: 04:31:04

Sequence POLR2F_1 : 16488 bp : 50.99% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1278   1297   20  2  2   50   89    58 0.746   1.59
gcgcacacaccagtcagcgcatgcgcactttccccgctctgtcctgcctcccggaagtga
tttcctctgggttacggcgcaggcgcaagataagctaggagccgcgcgagtcgtagtgtc
gctgtttgcgggtctccgcgcgggaccggggcgcagcggggtcgctgaggcgagggtgtc
ATGTCAGACAACGAGGACAA
gtgagtgcgggagcggagtggcctttgcggcaaccttggaaggggcggatgaggcaaggc
ttgggtcggctgaggagcctggcgtctaggggcaatgtctgaggggactggggtcctgag
ggggccggcggagccgaggaagggaagggcgggcgacccaggagcacagccccggctgga

 1.02 Intr +   4263   4332   70  0  1   92   78   163 0.877  14.88
ttttagtagagatggggttttgccttgttggccaggctggtcttgaattcctggcctcaa
gtgatccgcccacttcaatctccgaaagtaccaggattacaagtgtgatccaccgtgcct
ggcccctctttgattcttttaagtgatgctctaagtaactgatctcttcttcctgtacag
TTTTGATGGCGACGACTTTGATGATGTGGAGGAGGATGAAGGGCTAGATGACTTGGAGAA
TGCCGAAGAG
gtcagtattcagcctcaggctcccacctctgcagcccaagctgccaaatcgtctgacagg
tgatgattagctgaatgtgtctgccttctatttgtggtcaaggcccctgccataagcatt
cccagttagagtgagctgtgttccagtcttgcatagcagaacagccctgcagggtgggcc

 1.03 Intr +   6836   6966  131  1  2   87   66   160 0.885  13.19
tgcctcataaggttattgtaaggattacatgagttgttaggaagcagttatgtggtcccc
tggcatgcagtaagcattaacggtggctgtagcgagaattgtgattgttgtcattatcac
tctccctgtaacccaaaagtgccacctgagtctttccctcttttttgtcttggtgtccag
GAAGGCCAGGAGAATGTCGAGATCCTCCCCTCTGGGGAGCGACCGCAGGCCAACCAGAAG
CGAATCACCACACCATACATGACCAAGTACGAGCGAGCCCGCGTGCTGGGCACCCGAGCG
CTCCAGATTGC
gtgagtgattgccccttcactgtcttctccatctgtcaggccacagtaagctcttgtacc
gctgatctttcccagcctggcacctgaaaacagactctctgctctcacattccaaaagtg
gtgccgtccctgcgtaccaggcattgagctagtcccctgccctcagggagcttgtgatct

 1.04 Intr +  14589  14660   72  0  0  114  108    94 0.968  12.52
gataggcctctgccagggaagatctctggcagtgcccctacacaccactccctactgtgc
ctgcctacctagaagatgacgtttctaggtggggaccaggatgccgttccaccctcactg
cctgttgggcccttctccctgggtttgtagtctccctaacacctgtccctatccctacag
GATGTGTGCCCCTGTGATGGTGGAGCTGGAGGGGGAGACAGATCCTCTGCTCATTGCCAT
GAAGGAACTCAA
gtaagtcactcaaatcatggttcacttctccaaatctctgggaggcatctgttgggctct
ctgttgcaccctttgctcccacttgcctggctggagaagttgatgcttattcctacagat
ccttaggaacagctcaccaggaagtaggaggaagagagaagaggaggcagggaaagtggg

 1.05 Term +  15115  15205   91  1  1  106   49   231 0.999  18.19
cttgtctgatataaaaactttctttttcttgtaattgctttcttacaaagtacactcatc
agccccaagaggctgctcctaagacttctctttgcttgtgttttgcacacaatctgttcc
ttctgcggcagagctggggtcaccagccctcatgtacttgtgacttctcccctgccacag
GGCCCGAAAGATCCCCATCATCATTCGCCGTTACCTGCCAGATGGGAGCTATGAAGACTG
GGGGGTGGACGAGCTCATCATCACCGACTGA
gctggagtcatcttcctgcccttgccccatgcccaattttcattctcactttatatgtgt
aaataataaaatattcaactttccaacccccttcccctctgcttatctgcaatgtcacca
cctgttgcttccccgttaccgccatgctgcgtggagcatgcacctattccagtggccctg

Predicted peptide sequence(s):


>POLR2F_1|GENSCAN_predicted_peptide_1|127_aa
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIITD