GENSCAN 1.0	Date run: 16-Jan-104	Time: 04:06:23

Sequence KREMEN1_1 : 97615 bp : 45.67% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1214   1310   97  1  1   76  117   220 0.754  22.17
ggcgggccccaggctgcaggggcggtggcggcgctgagctgggcgggccggggcggggcg
gccgggcggccggggcggggctacactcgggccccgcgtcctgctcccatggccgccccc
ggctccccgcgctgccccctttaccccgggccgcgccccggggccccgcactgacggccc
ATGGCGCCGCCAGCCGCCCGCCTCGCCCTGCTCTCCGCCGCGGCGCTCACGCTGGCGGCC
CGGCCCGCGCCTAGCCCCGGCCTCGGCCCCGGACCCG
gtgagtgtgagcgaccccccgccgcccgccctgagcggagcccactcgaggggcgacaag
ggccggccggcctgagagccccctccctcccgcttcaggaccttccgggccccttcccct
cgcccctaggcgacgcccctcaggccgggatggtcccttcctgggacccgggctaccccc

 1.02 Term +   1440   2257  818  1  2  108   44   312 0.742  22.10
tcacgctggcggcccggcccgcgcctagccccggcctcggccccggacccggtgagtgtg
agcgaccccccgccgcccgccctgagcggagcccactcgaggggcgacaagggccggccg
gcctgagagccccctccctcccgcttcaggaccttccgggccccttcccctcgcccctag
GCGACGCCCCTCAGGCCGGGATGGTCCCTTCCTGGGACCCGGGCTACCCCCAGGCCCGTC
ATCGACGCCCCCGGGCCCGGTACTGTCCCCCGGCTGCAGGACCCGGTGCTCCTCAGCGAC
GCCCCTCAGCCCAGGAGGCCCTCTCCGCCTTGAGTCTTCCAAGACCCTCTGCGACGCCCC
CCGGGCTGGGACATCTTCTCTGTCTCGGGATCTGGGACCCGCTGCCCGAGTCCCTCAGCG
ACCCCAACCAGGCCGGGACGCCCCCTCTCCCCGGTACCTCCTGGGATCCCGTCCCAAGTC
CCCAGCGACTTCCCCCGGGCCGGGACGTCCTCTGCTCCCCGGTACCTCCTAGGATCCCGT
CCCAAAATCCCCAGCGACTCCCCACGGGCCAGGAGGCCCCCTGCTCCCCGGTACCTCCTG
GGATCCCGTCCCCAAGTCCCCAGCGACCCCTCCCGGGCCGGGACGACCCCTGCTCCCCAG
TACCTCCTGGGATCCCGCCCCAAGTCCTTCATCGACGCACCTTGCACCGGGACGACTCCC
CCGCTACAAGAGGCTATACGCCCCTCTCCGAGACCTCCAGCGACATCCCTCCCCTGGGCC
AAGGTCCCCTCCCTGAGCCTCACTGCGACGCCCCCGCGTCCCCCAGTCCTCTCCTCCCGC
CTACACCGGTGGAACCCGGCGCCTCCCCGCGCAGAGCAGAGCGGAGGCGGGAGGAGCCGG
CGCTCAGCCCCTTTTCCCGAGTCCTCGGCTGCACCCGCTTGGCGGACATTATAACTTCTG
CCTCGCGAGGAACGGGATGGACTTGTTCGCCCTGCTAG
aggcaggttagggtcctgggacgaccttgtacccagacggacgggacgtgccctctctct
ccgctgggccgctttgaacttccctatgactcaggtgatggcgcagaagggggagagaaa
aaaggaagcagtgatgggaaacttctccccaactgagtttagggtgctcttcctgagggt

 2.03 PlyA -   3543   3538    6                               1.05
 2.02 Term -   8920   8764  157  0  1   65   41   172 0.633   7.61
 2.01 Init -  28264  28251   14  1  2  112   73    23 0.002   1.41
 2.00 Prom -  28500  28461   40                              -3.56

 3.01 Init +  38872  38924   53  0  2   89   47    54 0.017   2.03
agaattccacagaggaagaaaaagctgtgcttacttatttatttgggggtgttgctgtaa
gactcgggggcacaattaagactgttggaagaatcagagtgactgaaaaggaagtttatg
tttagaaataaagttacagaggtagtgtggggccatatcatgagaaggggttggaccaag
ATGGCAGCTGTCAGATTTGGAACGGAAGTTGCAGATGAACAGCACAGGGTGCA
gtgagcttacggtcacgggtctgagggtgtggatgaatccacacttaacctgttgatgct
ctgaaagaagtaggataccagctgcagcgtctcagatgtacatagtttttctttccatgg
aggggagaaatcagctactgaggcaccagtgtggggtccttgaggcagaagatagtattg

 3.02 Intr +  47922  47998   77  0  2   36   94    62 0.012   0.76
tgaggtacatctttgaaagctgtctaccagagttggtacatatatttagctttctttgtt
ctcagctacagctttttctactagaccaaaccatctgatgtgtggctgtgaaacactaat
atgctcagtgtggtgggctgaagaatggccctccaaagatgttcatgatataatccctag
AATCTGTGAATACGTTACCTTAGATGGCATAGGAGATTTTGCAGATATGATGAAAGATTT
TGTGATAGATTATCCAG
gtgagaccaatgtaatcacagggtccttagagaggcaggaggatctgagtcagagaagac
agatgtgacaatggaaacagagggaggaagaagaggtgatgaaggaaacagagggaggaa
ggagaggtgatgatggaaacagggaggagggagaggtgatgaaggaaatggaggagggag

 3.03 Intr +  49440  49564  125  1  2   94   59    42 0.627   2.20
catggtttttagcagaggacactaaagcttccattttcaaagctggttgcttgttgttta
tttgtacctcaggagtggaaatactggctgagatgaaagtacctggcacaaatcgctttt
ccttcttggtgtttcacagccagatgttgcgaaattcttttgtttttcttttttctttag
TGCCTGGAAACCTTGGCTGCTACAAGGATCATGGAAACCCACCTCCTCTAACTGGCACCA
GTAAAACGTCCAACAAACTCACCATACAAACTTGCATCAGTTTTTGTCGGAGTCAGAGGT
TCAAG
gtgatgactctgtggctgtgtaactatagaaaaatataaagatgtaaatgcattttgctg
agataacttaaaaataagtgctaagtaaaataagccagacacaaaaggccacatattgta
tgattccacttacatgaattgtctagaataggcaaatccatagggatagaaagcaggtta

 3.04 Intr +  53346  53499  154  2  1   71   73   131 0.690   9.55
gtacttattgttcagcttgaaattaagtgttgcaagagtggaagaagggggaggtcccag
gggaagggaccctgggaagttgaggctgattgcttgctggaagcccaccctgccaggctc
cttcaggccatctgacatccctgatgatgcttaccgtgtgctgcttctctgttgtggcag
TTTGCTGGGATGGAGTCAGGCTATGCTTGCTTCTGTGGAAACAATCCTGATTACTGGAAG
TACGGGGAGGCAGCCAGTACCGAATGCAACAGCGTCTGCTTCGGGGATCACACCCAACCC
TGTGGTGGCGATGGCAGGATCATCCTCTTTGATA
gtgagtatgccctgtgcccatcactgcccaaggcacaggaacccttggaccagagcaaca
agcctgcccaccctccctcccttctatgtattcattcattcacttggcaatagacaatac
ttgtgactagaccctgggaatacagcacagtgcatgaagactcagcccctgccttctgga

 3.05 Intr +  65425  65757  333  2  0  108  116   367 0.997  37.04
tctccacagtcatttttcgagagtctcagcgattcgttttgtgactgtcaggttttacag
atagaaacaatgtcctaaatgggatcctgctcgttaggaaggctttagtgccttggtgtt
ggaagcgcgcctgtggcaaaggcccagactgagggcgtggtgtctttttctctcctacag
CTCTCGTGGGCGCCTGCGGTGGGAACTACTCAGCCATGTCTTCTGTGGTCTATTCCCCTG
ACTTCCCCGACACCTATGCCACGGGGAGGGTCTGCTACTGGACCATCCGGGTTCCGGGGG
CCTCCCACATCCACTTCAGCTTCCCCCTATTTGACATCAGGGACTCGGCGGACATGGTGG
AGCTTCTGGATGGCTACACCCACCGTGTCCTAGCCCGCTTCCACGGGAGGAGCCGCCCAC
CTCTGTCCTTCAACGTCTCTCTGGACTTCGTCATCTTGTATTTCTTCTCTGATCGCATCA
ATCAGGCCCAGGGATTTGCTGTTTTATACCAAG
gtaagacatctttgcctccttgggggttcttcagggcccacgtgccttgggcttctcttc
ttcacccttgtgacttgggcagttcttgcggggcagattgggcctcaggaactactgact
caacttgcagatcaccccgaggctgtggctccttccctacccccatttcataactcattt

 3.06 Intr +  66707  66865  159  0  0  103   69   229 0.969  22.46
ttctaaagggtgacagcctgacaggttctgttttggggctggtgggacccacctatggaa
ggaattgcacccagaattgaatcagagaagaactcttcttcataactcgtgctctcctcc
cgcacaactctttgttgtctccatagccctgtccccagttaattgctttttctcttccag
CCGTCAAGGAAGAACTGCCACAGGAGAGGCCCGCTGTCAACCAGACGGTGGCCGAGGTGA
TCACGGAGCAGGCCAACCTCAGTGTCAGCGCTGCCCGGTCCTCCAAAGTCCTCTATGTCA
TCACCACCAGCCCCAGCCACCCACCTCAGACTGTCCCAG
gtagcaattcctgggcgccacccatgggggctggaagccacagagttgaaggtagcgctc
ttgacagttataaagacaaaagcacttgggtgtttcttattcagaggcaggttgggatac
tggctctgtgacctatagtctgtcctggcttttgagggaaattttcttattagcttggtt

 3.07 Intr +  68365  68449   85  2  1   93   89    79 0.777   7.38
cctggggccccatgcttagcctgggtcagctgctcctgaggctaggtttgctagctgccc
tcccacaccggcctgcagggagcccctcagccagacttactcacttgggtattccagccg
acctcctttcgaaaaccaaccataaacaagtctggtaagctctgtcttttgcacttgcag
GATGGACAGTCTATGGTCTGGCAACTCTCCTCATCCTCACAGTCACAGCCATTGTAGCAA
AGATACTTCTGCACGTCACATTCAA
gtgagtacaagagggagctgcccaattccaggaaagggaaggctcagagttcattttcta
tgatgcttcatttgtctggttacaactgtagaataagcacatgattccaaagccctcagt
cctagggaacggaaggcagcagacattcccccttctttgtagagtgaaatgtacaactgg

 3.08 Intr +  76094  76212  119  2  2   55   22    85 0.351  -1.29
catcccagttccactgttcaccatgtgacctggggtgagtaacacggccctgtgtgcctg
ttttctcacctgtcaaatggagacagttatagtacctgcctttgtgaggcattgggctgt
atgaattattattacctgcagtatgttttccatcaaaggtagatgttcctttcattctag
AATAGAGGTGGGGGTTAAGAATGAGGAGGTGTCTGGGATGGTGCTCCGGTACCTGACATG
GGTGCCTGAGCGGAGAGAGGGGCCACTCTTCGACATAAGGAATGTAAAAGGAGCCAGGT
gtgagaggaaacctgatgagttcttttgggctaagtccactgcagtcgctgtgggacact
gaggcagagctgtccggcaggcattggacagacagcctgagccccccacaaggagcacag
ggctctgcacaacccaaggaaacatgggcaaaggtggcatcctcagggtgagtgttgggg

 3.09 Term +  78875  79050  176  0  2   40   49   171 0.339   6.32
gtttagtggacttgccttagttgctggtacctaagatagagattaagggccctcaagggg
tattcagacctcaaattcagccaaacacaggcgcagcttttcctgggtctgagtgagctg
aggaaagcacttttgaatgtgcaaggacaataagattaataaccactaccatctctgcag
TACGTACTGTGTACCAGACGCTGTGCCAAGTGACCAACAGACATTACCGAATTCATCTTT
GCCGCAACCCAACAAGGGAACTGAGGGTCAGAGAAGGGGTCCAGCCAGGGGCCGCCAAGG
TTCGGACTCAGCCTGGGACCACTGGCTCCAAAGCTGGGGGTCCTTACTCCTGTTGA
gctgcaggcccctccaacacaggcagtgggtgggcccccaaatagctcatcttcaaggat
atggcctccggaaagcccagggaaagtgtggatcgattttcctgggtcaaggaagaatca
aacctacacttctttacctatttgatgacacaaacccctttgagaaccaggggttggatg

 4.03 PlyA -  81443  81438    6                               1.05
 4.02 Term -  86482  86451   32  2  2  120   52    17 0.085  -0.68
 4.01 Init -  95734  95551  184  1  1   78   66   121 0.319   8.18

Predicted peptide sequence(s):


>KREMEN1_1|GENSCAN_predicted_peptide_1|304_aa
MAPPAARLALLSAAALTLAARPAPSPGLGPGPGDAPQAGMVPSWDPGYPQARHRRPRARY
CPPAAGPGAPQRRPSAQEALSALSLPRPSATPPGLGHLLCLGIWDPLPESLSDPNQAGTP
PLPGTSWDPVPSPQRLPPGRDVLCSPVPPRIPSQNPQRLPTGQEAPCSPVPPGIPSPSPQ
RPLPGRDDPCSPVPPGIPPQVLHRRTLHRDDSPATRGYTPLSETSSDIPPLGQGPLPEPH
CDAPASPSPLLPPTPVEPGASPRRAERRREEPALSPFSRVLGCTRLADIITSASRGTGWT
CSPC

>KREMEN1_1|GENSCAN_predicted_peptide_2|56_aa
MAPLQMFSSSIPGLYRLDASSTSLVVTAKMSPSIAKCPLGAKSPPVEITELEEMVK

>KREMEN1_1|GENSCAN_predicted_peptide_3|426_aa
MAAVRFGTEVADEQHRVQICEYVTLDGIGDFADMMKDFVIDYPVPGNLGCYKDHGNPPPL
TGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFG
DHTQPCGGDGRIILFDTLVGACGGNYSAMSSVVYSPDFPDTYATGRVCYWTIRVPGASHI
HFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDFVILYFFSDRINQAQ
GFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVP
GWTVYGLATLLILTVTAIVAKILLHVTFKIEVGVKNEEVSGMVLRYLTWVPERREGPLFD
IRNVKGARLRTVYQTLCQVTNRHYRIHLCRNPTRELRVREGVQPGAAKVRTQPGTTGSKA
GGPYSC

>KREMEN1_1|GENSCAN_predicted_peptide_4|71_aa
MVTADPEQVTQSFTTVPDDKTWHWGRMPVGSPSFRSGFVVACCVLFPREDKGELTPKGPK
VVPSYILFSAK