GENSCAN 1.0	Date run: 16-Jan-104	Time: 04:07:30

Sequence EWSR1_2 : 34626 bp : 44.87% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1244   1256   13  1  1   86  100    17 0.597   2.46
ggacaagagttgcggacgcgaagaacgagtaagcggtggttcatccctcctgaccccacc
cccgtggcctggcccgatggtcgcgcccggggttgcgagatttgcgcctgcgcagtgcgg
cgcctagagggaaagcgagagggagacggacgttgagagaacgaggaggaaggagagaaa
ATGGCGTCCACGG
gtgagtatggtggaactgcggtcgcgccggcggtagccggaacgcccaaactgggggtcg
ttcgtctctgggcttggctgggaagactgagtggagttgccgagagggggttgaggcacc
cgccgcggcccgacgagctcggggatccgcattcctctcccctcccccaaccgggcgggc

 1.02 Intr +   5123   5159   37  0  1  108   98    -8 0.504  -0.48
tggtttagacttttttttctgttagatgttgagaggtaagggggactcatttggacctgt
gttggcaggtctccctacagtttaaagaattcttcctgccacgtgaattctttccccctt
ttttctcttctccttgtttctgctaactttacactatttttcctccttgttttcctctag
ATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGG
gtaagtcagtcttttataaccgtattttgtgtgtgattaatattttttgaatatggagcc
ttctataattgtagaggtggtatttgaatgttctctattcaagttattgcatttaattct
tttgcagctacagtgcttacaccgcccagcccactcaaggatatgcacagaccacccagg

 1.03 Intr +   5287   5338   52  1  1   82   89    53 0.964   3.71
ccttgttttcctctagattacagtacctatagccaagctgcagcgcagcaggggtaagtc
agtcttttataaccgtattttgtgtgtgattaatattttttgaatatggagccttctata
attgtagaggtggtatttgaatgttctctattcaagttattgcatttaattcttttgcag
CTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAG
gtaatctttaaaataattacatgtagctgcacctccaagtaaaatcagtatattatccag
ttatctttcagttatccagtaaaacaaatgagtaatgtgtttggaatagtaaaataccca
ggcattttaaactttcacagtgggagtgcgaaggactccattgtgccatcataaatgaaa

 1.04 Intr +   6648   6771  124  2  1   22   95   102 0.836   4.46
agataagggataacattcatgatactgtgattatttgtcttgttttgttgtttttgtttt
gtttttttaatcttctagaaaggaatgtttttgattttggttctccaatttagtccattt
tattgctaaaatacaaaagttcatgtatgaagttcttgcattcgtttttttttggagcag
GCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAG
GCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCC
ACTG
gtaaggcctgccttggagagatttttgggtcgttctggctagggcattggctaagaagct
tattagtcatgctttcggatgtatattctggtccataccttggcatctggggaatccttt
attcttaggaagaggtattttttctctttcttccctactcttatagtcttgagagatctc

 1.05 Intr +  10937  11123  187  0  1  113  116   145 0.998  18.55
attcagagaacttaggctttaaataccagtttgttgctactcttgcggaagggggaatat
ttaaagggattcaatatcctgatggtttaaagtaagtggtttacaaattgttctgataat
gagtgtctaggcagatctctgaggggacctgaaatctgatgcagctctcctttgttctag
GTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTG
GTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGT
CTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCAC
CTACAAG
gtaaggccatggtgtccttaatgcgtcagtcttatgttggagggaaagaaagcaactgtg
tacacttaaaataatctgtggtttagttccttattagtggttgctttcatatactctcag
atgttcactgttagtaactgatgtgctagaacataccacagaaatattctgcatttaaca

 1.06 Intr +  15297  15464  168  0  0   88   82    19 0.501   0.36
gacactgagtttgatgtagtttactttaggattgtatttattattgtatttatttccagg
cttaatcataacattgcttattgctcgtagctttgtagcattcttacccaggagttttgt
ggttgaccaaccacacaaaaaaagtcactttttaattttatttattatttctcctcttag
ACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTA
CAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAG
CTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAG
gtcagtctactttttgtggcaaaacaaaaacagtgacaaaacagtttttttcaggttgtt
gaccagcttgctttgacttcttcagctaaggtatgttatctgactgtcgcagtgataagt
catctgaccatacttggttacattaaagcctgagatctagggtcccatagtgttgcctgg

 1.07 Intr +  19830  20041  212  0  2  117   70   105 0.839  10.16
ttattctgaacacaaaagtatttgctgagttgaaattcaaattgttgatgtgtagaaagt
aactactgttttatggatgtctgtgtcacatggtgtgaatgtctcttttattcaggggat
ttgaaataacaagcctctttctaaaaaagcttttttttttttctcttctctctctttcag
CTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTA
TGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCA
GCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATA
TAGCCAACAGAGCAGCAGCTACGGGCAGCAGA
gtgagttgctaagagagaaaaccaaataagaatgaatgtgtttagagtttttttgtgggg
ttgattttttttgttggtttgtttttcttttgagatggagtttcactcttggggctgagg
ctggagtacagtggtgccatctcagctcactgcagcctccgcctcctggttcaagcaatt

 1.08 Intr +  21513  21662  150  1  0   69   64    96 0.879   5.43
atccagcagttttgttgaacttaaaagagcctacctattaaggatgctttatcgtgatgt
aaagaagatggtgccttggttagtgccttggaattgaggattttgtgattccaggagaaa
gtacatcaggcagtggtgtaaatgctggtccatggcttacagatgtgactctttcctcag
GTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGAT
TTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAG
GGGGATTTGATCGTGGAGGCATGAGCAGAG
gtgggcggggaggaggacgcggtggaatggggtaagagcaaaccttttctccttttacct
aattttgtttcatccataggattttcagtggaaagaagggactgaaagacataagaaatt
aatttctgcatttccatggacaatctgttgagctcaagccatcttctaaaacatggaaat

 1.09 Intr +  25044  25076   33  1  0   91   59    57 0.686   1.29
cctagcaaacctttcacaaatgttaaagagacactgctccattttagcagtgcgggtcat
tttgagtttaatgaatccccatcaaatggtggtatagtagatagctatgtgtgtttgtaa
ggtttgtagcttgcaagacgtgcactaataatattttatatgatctttcctggttggcag
GACCCATGGATGAAGGACCAGATCTTGATCTAG
gtaattttgaattctagttgtgcttcatatcgtgctttgtaaattaatggtacagaggta
aatgcatgcgtagagttcagcagccttatagaccagtgtgatattcttgctgtcaaggac
agtttgggaaatcctatgtgagcatctactcataattgccttaagtgaagtaaaccaaaa

 1.10 Intr +  25395  25513  119  1  2   87   86   107 0.993  10.58
tgagcatctactcataattgccttaagtgaagtaaaccaaaagtttgatagcattcttct
tagtatgcttggtagttttcttagatttatgatgaatatccttgggcagtagtgatcagg
tagttaagaaacccctatagatacatgataataattctcctgtcttgttgtctctgaaag
GCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAA
ATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAG
gtcagtaaaagcataaccaggtcatctggcagaactttaaaccacagagcattttaaaga
gattgaattgatgttgagagttgttttctaaggttgcctttgcctgacttctttctaggt
atcttatggtttgttcctttttaaaaaagattagcctttttttttttttttttttgagac

 1.11 Intr +  29147  29386  240  1  0   77   61   260 0.918  19.95
taaagcagggatagaggagaaaataacttagaattctgaaaaacttaaaagcggagaaac
ggtgacatttagtgacttactacatgtgagaaattggtacttttcctggattttgcctgg
acttttttctcccaaattagtatattctagtcatgcctaactatgctattctttgtctag
ATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAG
CCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAA
TGGTTTGATGGTGAGATGTACTCACTGGCATTCTTAATCTCCCTGGCTATAGAATATGGC
ATGAGGGAGAAACTTGTGAACCATAGGAGCAAGAAGACCTTCCATCTCTTCCTGGGGGAG

gtagatggccggtctccctgcagtagtagtagcacccagccattgaccctggatttggag
atccctttattttgaggcattagtattacaaatcaaccttgcttaaagtggcaaacactt
cctaagcacagattatcagaaggtacagaaaacccttcaaaagaacatcttagccagtgt

 1.12 Intr +  31641  31803  163  2  1  107   41   118 0.597   8.55
cgtggaacacgctcctcacagggaagggggctgatggcctgagccacacggaaacacggg
acaggtgatggggaaatgacagcagtagtatctgtgggtttacttagtgatttttatttc
ctatagcaaatttggtgctacagagaaatgatttgctgtttcttgttgttcttgttgtag
GTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAG
ATAGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAG
GAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCC
gtatgtacttgtcttggcaaattgataccctacgagtgaagccacccttccctcacccca
tccccactctagagtggattgctctgtctagaggaacagaatgatgaccctgatggctgg
ttagggacactagtcagccattcactggacgcttcagagccttctgaagattgatttgac

 1.13 Intr +  32142  32239   98  1  2   60   77   -14 0.482  -5.57
gccttctgaagattgatttgacctgtcctgtgggtgcaatgctgcctgaggctgtgccct
aaagcatgggtgtacatagatcctcttgatagtgagtgtgtacctgttcacacaccacct
ttccttgtttatcttccttagttcaattggtgatttctgctgtgatgtaattgtatgcag
GGGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAA
GCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGG
gtaggtgcaggtttcatgagtgtcccctcagcttcctggtgctaaacctcttttcttatt
tgtgggcttggtaaactgcagttgccctctgcttaacaactttgagttgtcgtgtcctca
tttctaaattgtcagcccgatgccgagattgagtgaagtgtctggtttgttctgctgtga

 1.14 Term +  32507  32704  198  1  0  119   45   261 0.925  22.30
tctgcttaacaactttgagttgtcgtgtcctcatttctaaattgtcagcccgatgccgag
attgagtgaagtgtctggtttgttctgctgtgagagaaggaagcagagcagcttccacag
tgtccacagggcctctgcagccacccactgactgctttcgccctgctattctcaccttag
GTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGG
ATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCC
GTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGG
GGCCCCCTGGACCTTTGA
tggaacagatgggaggaagaagaggaggacgtggaggacctggaaaaatggataagtaag
tgctggtgaaaagcagctgtgggccgccaggcacagtaagaggacagcccttcccagctt
ggttggcgcaagtcctcatgtctctaggaagcttgtgatagtggttgggaggagccagga

Predicted peptide sequence(s):


>EWSR1_2|GENSCAN_predicted_peptide_1|597_aa
MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTAT
YGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGT
QPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYP
MQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSY
PPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNR
GRGRGGFDRGGMSRGPMDEGPDLDLGPPVDPDEDSDNSAIYVQGLNDSVTLDDLADFFKQ
CGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGEMYSLAFLISL
AIEYGMREKLVNHRSKKTFHLFLGEVQEAQEVLGDPWVAWEAVEEIEEASLQEDPGVPEG
TPLEEETSSTELETGSVPIRVVETRTSPGEQSATSVRPQSLKASSRHPFRPRVVIVAEVA
LVACGEEEVASWIVVVPVECSEVAVVETEVASVVAGAWTEVALVEEDEVALGGPLDL