GENSCAN 1.0	Date run: 16-Jan-104	Time: 03:45:02

Sequence DGCR6L_1 : 8206 bp : 59.72% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1298   1407  110  1  2  105  101   247 0.902  27.50
ggcggcggggcgcggggcagggcggggcaggcggccaggccctctcgggactgtcgtaaa
agggggcggagcgcgccgcgcgtgggacaatcgtaaaaggggcgggacgcgccgcgctcg
ggatgtcgtgaagctgggggagctcgtcgccgccgccggcggctagcgggcgtccgcgcc
ATGGAGCGCTACGCGGCCGCCTTGGAGGAGGTGGCGGACGGTGCCCGGCAGCAGGAGCGA
CACTACCAGTTGCTGTCGGCGCTACAGAGCCTGGTGAAGGAGTTGCCCAG
gtacgcaggcggggcgggcggaggcctgcggaggcggcttcgtttcccgccggggctcac
cgcgcccccctacccgcagctctttccagcagcgcctgtcctacaccacgctcagcgacc
tggccctggcgcttctcgacggcaccgtgttcgaaatcgtgcaggggctactggagatcc

 1.02 Intr +   1487   1647  161  2  2   88   69   363 0.065  35.22
tacgcggccgccttggaggaggtggcggacggtgcccggcagcaggagcgacactaccag
ttgctgtcggcgctacagagcctggtgaaggagttgcccaggtacgcaggcggggcgggc
ggaggcctgcggaggcggcttcgtttcccgccggggctcaccgcgcccccctacccgcag
CTCTTTCCAGCAGCGCCTGTCCTACACCACGCTCAGCGACCTGGCCCTGGCGCTTCTCGA
CGGCACCGTGTTCGAAATCGTGCAGGGGCTACTGGAGATCCAGCACCTCACCGAAAAGAG
CCTGTACAACCAGCGCCTGCGCCTACAGAACGAGCACCGAG
gtgcgcgggggcagcgggatgaggtgccgcctcctccgggtcggcgcctccgggcagctc
ttggtatctgtgcagatcagctccttccttggaagtgttcggaagaggtctctaagattg
acaaaatcaacgggcgcagagactgagacagcgcctttttggtgatcagtgggtccaacc

 1.03 Intr +   5067   5167  101  1  2   82   69   118 0.937  10.29
caccagataagggcccggccctgggtgacagtggggtgggaggatggaggaggctggcat
cctccccactgcagacacccctttggcctggctgctctgctgggctggcaaggcaggtgc
ccatgggtgagggctgctgccgagtcccaccgcctgctgacgggctctcatccctcccag
TGCTCAGGCAGGCGCTGCGGCAGAAGCACCAGGAAGCCCAGCAGGCCTGCCGGCCCCACA
ACCTGCCTGTGGTTCAGGCGGCTCAGCAGCGAGAACTAGAG
gtactgggggcgcaggcagggtggccggcccagctctcctgtgggcaccacctggctctg
ctgactgggctgagctgaaggggtgtgggggctcaggcatgggtggctgtcctgggcctg
agtgggacactggaggcctagtgagtcccaccaggtggctcctctttgcggataccaagt

 1.04 Intr +   5810   5950  141  1  0   76   82   300 0.980  29.93
cttcaggggttcacatggccgaggagaggcctgggtgtggtgaggatgcaccggtggtgt
cagagctgctgccactggggacggcagcaggagcatgtgtttgagctgccctcacctccc
cgccccctgatggcagagctgccctcacctctccccctccgcgccctggccccatggcag
GCCGTGGAACACCGGATCCGTGAGGAGCAGCGGGCGATGGACCAGAAGATCATCCTGGAG
CTGGACCGGAAGGTGGCTGACCAGCAGAGCACACTGGAGAAGGCGGGGGTGGCTGGCTTC
TACGTGACCACCAACCCACAG
gtcagtgcctgggcctgctctgccctagcccgagtgccccggggccccattccatctggg
gttttactgctggtccctggggagccaggctcagggtatgggggtgaagtggaaggattg
aggctctggaaaggatttctgtgccattcccagcacggaggccaggcccattccctacag

 1.05 Term +   6462   6611  150  2  0   90   42   124 0.907   6.86
ggctcagattccgagtggccctgttgggggcagaagctcagattccaccctgtcctggca
ggccatgaccaggcttcacaggatggtcgcccccgtgggctcactgcctggcacccttgg
gccgggatgaaaggggcctgggggtcactctggccttcatggggcccctctgtatcccag
GAGCTGATGCTGCAGATGAACCTGCTGGAACTCATCCGAAAGCTGCAGCAGAGGGGCTGC
CGGGCAGGGAATGCAGCCCTGGGACTGGGAGGTCCCTGGCAGTCGCCTGCTGCCCAGTGT
GACCAGAAAGGCAGCCCTGTCCCACCATAG
ccacaggcagcagaagtctgggcagagttcatcttcttgacctttggccactgccttccc
agctgcccgcagggggttccccctgctgaggagagaccaggtggaccccagctgcctgtc
acccttcatctgggacttgctgtcaaaccctaggatagtctcataaaggggaggctgggc

Predicted peptide sequence(s):


>DGCR6L_1|GENSCAN_predicted_peptide_1|220_aa
MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTV
FEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQ
RELEAVEHRIREEQRAMDQKIILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLL
ELIRKLQQRGCRAGNAALGLGGPWQSPAAQCDQKGSPVPP