GENSCAN 1.0	Date run: 16-Jan-104	Time: 04:00:03

Sequence CRYBB3_1 : 9899 bp : 51.30% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   2740   2814   75  0  0   98   79    59 0.953   7.06
aggtgctcaatggatgtttgctgaatgactgaatgtcgatcataagttacagccacgccc
catgggcagcaaggctctgtagctcatcctggactccagtcacatcaacacctggcttct
cccgggtggatccagtgaaccattttcttttggtttgaagccagaggtgttcctggggag
ATGGCGGAACAGCACGGAGCACCCGAACAGGCTGCAGCTGGCAAGAGCCATGGAGACCTT
GGGGGCAGCTACAAG
gtactgggcagggagggggtcagagggcccaggctactcctgggcctcagggtcatcttc
ccagccaagcagcacctctgcaggaaggaagagccatccttccaaccacccaggccagga
caaaacgctccgggtgggtcctctcactgccaccctcccgttagaaacttgcttcatgac

 1.02 Intr +   4017   4135  119  2  2   53   78   194 0.998  14.67
gttcctgaaggcgtttccctccatgaccattagagggcagtgcaggcccacctcagtgcc
agctccaggctggagagatgcagaaagcagagggtacctccctctaatgcccaaaggagg
ggcagaggctggagctgggagcctagcagaggtgggatgtttaggactctgctcttctag
GTGATCTTGTACGAACTAGAGAACTTCCAAGGCAAACGCTGCGAGCTCTCGGCCGAGTGC
CCCAGCCTGACCGACAGCCTGCTGGAGAAGGTGGGCTCCATCCAAGTGGAGTCCGGGCC
gtgagtacctagacccccagtccctcgccacagccctgagccttctgggagtgtggaggc
cccagtctgagctctagatctgttgtggggcttttgacagctcccctgccttctctggcc
tcgttttccgcatctgtaaaatgagagttgaagaattctctagaatcctagatgtctgca

 1.03 Intr +   5106   5238  133  0  1  115   68   104 0.997  12.25
ctcagacagttcccggtatgtcctagcagctcctttaattacaggtccaggaattagcag
tagggttggagggagggtacaaggttcaaggtcagcagctcttggacacttctctcacta
aacttgaatccttcctcagctgcagcaaaggtgacccagccaagcctcttcctccctcag
GTGGCTGGCATTTGAGTCCAGGGCCTTCCGCGGGGAGCAGTTTGTTCTGGAGAAGGGGGA
TTATCCTCGCTGGGATGCCTGGTCCAACAGCCGTGATAGTGACAGCCTTCTGTCCCTCCG
GCCTCTGAATATT
gtgagtgtggttcctgctcacttctgggtgttcctggaagcagggtgcactgagagctgg
tcaggcagctcattgcacaagctgggctgagggtttggcccatatggacctggcctggga
agggccctcatgtttctgatttgaacaattgtgtgggacaagaagtgggatattgaaggg

 1.04 Intr +   6563   6705  143  1  2   72   77   215 0.991  18.46
ccgtccctcctacagtgaatttgggggtggaggcatctcctgaggcccttccctcctgca
gcaggtttgggggtgggtgttattttgtggtgacctgttgattctttccggcatctggag
cctccttgacctctgttctggatatgggagcagccgctcaccccacgatattgccctcag
GATAGTCCACATCACAAGCTGCATCTGTTTGAGAACCCAGCTTTCAGTGGCCGCAAGATG
GAGATAGTGGATGATGACGTGCCCAGCCTGTGGGCTCATGGCTTCCAGGACCGTGTGGCG
AGTGTCCGTGCCATCAACGGGAC
gtaagggacccaaccctcacccttgccccatcttctggtcagccatgcctctggctccaa
acagaatcagtgcccatagtttcttattattttatttatttatttatttatttttgagac
ggagtcttgctctgtcgcccaggctggagtgcagtggcgcgatctcagctcactgcaagc

 1.05 Term +   8390   8555  166  2  1   86   48   359 0.999  29.40
gataaggctagagatgctttgttaagggtcctgtgagcagggtaaagagtttggattcat
cccaagggctctggggagctaaagaggaatgtaggcaggcagagtgcatggtcagatgct
ggctggaggcagggtgactggaagcagaccgtccacatctcaaccttggtctcccggcag
GTGGGTTGGCTATGAGTTCCCCGGCTACCGTGGGCGCCAGTACGTGTTTGAGCGGGGCGA
GTACCGCCACTGGAATGAGTGGGACGCCAGCCAGCCGCAGCTGCAGTCTGTGCGCCGCAT
CCGTGACCAGAAGTGGCACAAGCGGGGCCGCTTCCCCAGCAGCTGA
aaggcacccagacttcaaggacccagacccaccctggggggctgcaagggcaagaagagg
aggctccagggttggggcgagggccgacctgtccacccttccctggaatctgctcaataa
agcctggggttggtcccccacccgccacgttcctcggcatcacttcctgagggagccagg

Predicted peptide sequence(s):


>CRYBB3_1|GENSCAN_predicted_peptide_1|211_aa
MAEQHGAPEQAAAGKSHGDLGGSYKVILYELENFQGKRCELSAECPSLTDSLLEKVGSIQ
VESGPWLAFESRAFRGEQFVLEKGDYPRWDAWSNSRDSDSLLSLRPLNIDSPHHKLHLFE
NPAFSGRKMEIVDDDVPSLWAHGFQDRVASVRAINGTWVGYEFPGYRGRQYVFERGEYRH
WNEWDASQPQLQSVRRIRDQKWHKRGRFPSS