GENSCAN 1.0	Date run: 16-Jan-104	Time: 03:47:34

Sequence CRKL_1 : 35278 bp : 46.17% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1710   2020  311  2  2   77  101   494 0.931  46.39
gcgtcggaggatgctgcgggcccggagccgagaggaaagtgctggcccagccctctgagc
gctcctcgaggtgtgcgagaggcccttcctcggccccaaagccgtctgccgggctaaggc
gtgcagagcaggcgaggacagccgccgcccctaccgccgcagagtccccggtccaacacc
ATGTCCTCCGCCAGGTTCGACTCCTCGGACCGCTCCGCCTGGTATATGGGGCCGGTGTCT
CGCCAGGAGGCGCAGACCCGGCTCCAGGGCCAGCGCCACGGTATGTTCCTCGTCCGCGAT
TCTTCCACCTGCCCTGGGGACTATGTGCTGTCGGTGTCCGAGAACTCGCGGGTCTCCCAC
TACATCATCAACTCGCTGCCCAACCGCCGTTTTAAGATCGGGGACCAGGAATTTGACCAT
TTGCCGGCCCTGCTGGAGTTTTACAAGATCCACTACCTGGACACCACCACCCTCATCGAG
CCTGCGCCCAG
gtacgcgagagccctccccgaccgcggaggaaggtcgagaaccgggtctgtcgaagagtg
cttgtataggggggtggggcgcgcttgaacccatattccccgcattctgaaccaaattat
tttccagaaggccttcctaacagaaagctagtgtcaggatctgggtcactggataagagg

 1.02 Intr +  17554  18019  466  1  1   73   83   246 0.471  15.73
cagagtttgcagtgagctaagatcacgctattgcactccagcctgggcgacaagagcaaa
acttgtctcataaaaaaggaaaataatttattatagaggagagtggtatattaagaagtt
tgacaggcactggcttagagtaagatttttctcttagagtaattttctttctctcttaag
GTATCCAAGCCCACCAATGGGATCTGTCTCAGCACCCAACCTGCCTACAGCAGAAGATAA
CCTGGAATATGTACGGACTCTGTATGATTTTCCTGGGAATGATGCCGAAGACCTGCCCTT
TAAAAAGGGTGAGATCCTAGTGATAATAGAGAAGCCTGAAGAACAGTGGTGGAGTGCCCG
GAACAAGGATGGCCGGGTTGGGATGATTCCTGTCCCTTATGTCGAAAAGCTTGTGAGATC
CTCACCACACGGAAAGCATGGAAATAGGAATTCCAACAGTTATGGGATCCCAGAACCTGC
TCATGCATACGCTCAACCTCAGACCACAACTCCTCTACCTGCAGTTTCCGGTTCTCCTGG
GGCAGCAATCACCCCTTTGCCATCCACACAGAATGGACCTGTCTTTGCGAAAGCAATCCA
GAAAAGAGTACCCTGTGCTTATGACAAGACTGCCTTGGCATTAGAG
gtaaaatctgttcagattagctttttgggtcctttgacatttggttttaatttttagttt
tagtttagtttctgctcatttaagcttatattcatggaattagagcactggatgattttg
gaagatacgcactgttagcgtttcattttaaaatttttttatagagacgaggtctctaat

 1.03 Term +  33486  33620  135  2  0   94   38   159 0.890   9.52
gttagaggttacattgagcagggatctcaccactacactccagcatggctaacagagtga
gaccctgtgtctaaataataatgtatgggccctttggataaggtagtgtttgtgatttaa
tgtaaactgtctttttcttgttgcagagaaatgctaactttgtcttcttcatccatacag
GTTGGTGACATCGTGAAAGTCACAAGGATGAATATAAATGGCCAGTGGGAAGGCGAAGTG
AACGGGCGCAAAGGGCTTTTCCCCTTTACGCACGTCAAAATCTTTGACCCTCAAAACCCA
GATGAAAACGAGTGA
ttgctgttgccctgtttcctgctgctttgttgttctgcctgtcctagtctcctttgaagt
gggaaagcattttctctcataggcaagtcacactgcattgccgaagtccagctttctgca
gactggcagtcgcacacacatttggaatgcacacagcggctgcctcctgatgtttgtatc

Predicted peptide sequence(s):


>CRKL_1|GENSCAN_predicted_peptide_1|303_aa
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPT
AEDNLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPD
ENE