GENSCAN 1.0	Date run: 16-Jan-104	Time: 03:44:20

Sequence ARVCF_1 : 49288 bp : 58.15% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.02 Intr -   1222    558  665  2  2   62   75   308 0.875  19.84
 1.01 Init -   2000   1673  328  2  1   69   53   145 0.855   5.13
 1.00 Prom -   2261   2222   40                              -5.05

 2.01 Init +   7232   7314   83  1  2   60   81    73 0.678   4.34
ccacaaggcgggagcggactctagggaggtggagcagatgtcttatggggctgtgagcac
ctgcgtggggcaacaggaccctgagcctggctaccctggggtgggaatactgctgtgctg
tgtgtgatggggaagacgtcattatcagtccacatctctgaaggatcacgtttctgaagg
ATGGTCAACAGCATTAGACATGCTGACAAGGAACCGTGGCAGCCCAGTGTCACCTACAGT
CCTGGACATGTGGGGGCAAGAAG
gtacacatgagtgtgtggttatgagtcaggagcaccacgggatgaccttcagatcaggca
tgacaaggtcctgcttagaggacggtctgggcttgtgtacctttatccggcagggaccta
cccagctggattgacctcactcatgccctctggtttccctgcaggagccagagcctgcag

 2.02 Intr +   7479   7532   54  0  0  121  109    10 0.634   5.63
atgtgggggcaagaaggtacacatgagtgtgtggttatgagtcaggagcaccacgggatg
accttcagatcaggcatgacaaggtcctgcttagaggacggtctgggcttgtgtaccttt
atccggcagggacctacccagctggattgacctcactcatgccctctggtttccctgcag
GAGCCAGAGCCTGCAGGGTGGGTGTCGGGACATGCTGATCTTCCCTCAAGACAG
gtgagtggcctgggtttagcttggggacatcctctcccacataggacagcagagtgttct
ggtgggcctggcgggtgggggtgacagggatggactggccctggacactgtgtgctcctg
gtccttctcaccctgggtaggcacagcccctgggctggacagggtggatgtgagggcctc

 2.03 Term +  13508  13526   19  2  1  111   44     8 0.079  -2.63
gtagctttgtagtaagttttgaaatcaggaagtgtgagtccttaaatgttgttctttttc
cagattgttttggctctttgggctccttaaagatcgatataaatcttatgatagatttct
ctgtttctgcaaacaatgtcattgggattttttttttcttttcttttttttttttgacag
GTCTTGTTCTGTCATCTAG
gctggaatgcaatggtgtgatcctagcttactgcggccttgaacccctgggttcaagcag
ttctttagcctcagcctctgactagctaggattacagatacatgctactatgcctggctg
tcattgggattttaataggaattgcactgaatctgtagatccctttcagtagtatcgtca

 3.04 PlyA -  14098  14093    6                               1.05
 3.03 Term -  15914  15840   75  2  0   45   46   103 0.612   0.55
 3.02 Intr -  20238  20095  144  0  0   41   50    90 0.755   2.16
 3.01 Init -  24092  24006   87  2  0  103   37   112 0.722   8.35
 3.00 Prom -  24138  24099   40                              -8.59

 4.01 Init +  26128  26181   54  0  0   80   77    56 0.778   3.26
gctggctccatccagaccagtgagcagcagtgctgacgctctggggatgtcacccgcagt
gcgtgtcctccccgtggagggccctatattggtgcaagggcaagggatccagcggagttg
gcctcagtgggctggcgggactgggcaggaggatgcctgagcagccctgggcacccggcc
ATGCTCACTGTGCTCCGGGCAGTGTGGCCTCGTGGCTATGCCCTGCCCACTGTG
gtgagcctggattggagctccgcatacttgtcctgcttctttttacccatgaaaaacaaa
cattctgggcagccagggggcaagctgggagggaaagtgctggtttgtctctgcggctgc
caagccctcatggcccccgcctgctcccctggggctctggggccctgaggggcaacactg

 4.02 Intr +  27175  27402  228  0  0  104   92   249 0.905  26.19
cggccagcctcggattaatggcttttaatttagaatttaatcagtgtgcttccctctaga
gggctggatgctctggtctgggagtgagttgtatggtctgtgagtggggcgggcaggggc
ccatgatggccttgccaggctgtgccccaccccactgagcttactctgctttgcctgcag
CTGGCGGGCGCTCTGGTCATGGAGGACTGCAATGTGCACTCGGCCGCCAGCATCCTGGCC
TCGGTGAAGGAGCAGGAGGCCCGCTTCGAGAGGCTGACACGGGCACTGGAGCAGGAGCGG
CGCCATGTTGCCCTACAGCTGGAGCGTGCCCAGCAGCCTGGCATGGTCAGTGGTGGCATG
GGCAGTGGGCAGCCCCTGCCAATGGCCTGGCAACAGCTGGTCCTCCAG
gtaacagcctagtgacttgggaagggtgaaaattgccaagtgggaaaacaatcagtgggt
cctggtggaccacaagccagcatgcgctcgcttattgcaagatttgctggggctcctggg
gaggaaaggaaaatgggatcccaggttgggctggaagtcccacttgggtgtactaggcac

 4.03 Intr +  35896  36054  159  0  0   97   86   164 0.796  18.48
ttgctgtccttgtcagcttgggccgaaacaggccttggggtgggtgggttcaggaccagg
aggaaggcaccctggtgtgctggccagcatgagctgaggcagagctgctgtgtgtggaga
cctgcactccaggggtgactgagcagcaggcctgcccaccaatgtccctccttgccccag
GAGCAGAGCCCAGGCAGCCAGGCCTCACTGGCCACGATGCCGGAGGCACCTGATGTGCTG
GAGGAGACCGTGACGGTGGAGGAGGACCCCGGCACACCCACTTCCCATGTGTCTATTGTC
ACATCCGAAGATGGCACAACCCGGCGCACCGAGACCAAG
gtatggccaggcccaggcagtgggtgggtgagcagggccaggctgctgcagctgtcccac
ctgcagagtggacatggaagcttgccacgtggggcctctcattgctcgagtgggaaatta
aggccagccagaccccagcaaagcagtttctaggcctctcgtgctaccccacctacctgc

 4.04 Intr +  36250  36776  527  0  2   82   99   622 0.965  55.82
ggcagtgggtgggtgagcagggccaggctgctgcagctgtcccacctgcagagtggacat
ggaagcttgccacgtggggcctctcattgctcgagtgggaaattaaggccagccagaccc
cagcaaagcagtttctaggcctctcgtgctaccccacctacctgcctatccatccaccag
GTCACCAAGACTGTCAAGACGGTGACCACTCGGACAGTACGCCAGGTGCCCGTGGGCCCA
GATGGACTCCCCCTGCTGGATGGCGGCCCCCCACTAGGCCCTTTTGCAGATGGTGCCCTG
GACCGGCATTTCCTGCTGCGTGGTGGTGGCCCAGTGGCCACACTCTCTCGAGCCTACCTC
AGCAGTGGGGGTGGCTTTCCCGAAGGCCCCGAGCCCCGGGACAGCCCCAGCTATGGCAGC
CTGTCCCGAGGGCTGGGCATGCGGCCCCCACGTGCTGGCCCCCTTGGCCCAGGCCCTGGT
GATGGCTGCTTCACACTGCCTGGCCACCGGGAAGCCTTCCCGGTGGGTCCTGAGCCTGGG
CCACCAGGTGGCCGCTCCCTGCCCGAGCGCTTCCAGGCAGAGCCGTATGGCTTGGAGGAT
GACACGCGCAGCCTGGCCGCTGATGACGAGGGTGGCCCTGAGCTGGAGCCTGACTATGGC
ACGGCCACAAGGAGGAGGCCTGAGTGTGGGCGGGGCCTTCATACCAG
gtgagctgcaccccgtcccctgtggctacctcctctgggaagtctgccctccacccccca
actacagagtgccccacttgtcaagtggcgcagttgagttagtcatgcatgttagtttga
attggccttggctctcgtcagggacagaagaaaggtggaccctggggtggtaggagttcg

 4.05 Intr +  37745  38244  500  2  2   79  105   953 0.988  90.10
tctcactgggctggtgcatgactctctgtgtccccaccatgctccgggccaagatacagg
tgctctcagcccagcgctgctgggtgagtttgcagtcctgaagaaggtgtgatggggcag
ctcagaggcagggctggcggctgctgtgacgatgtccacgcgccccacttgcctgtgcag
GGCCTACGAGGACACAGCAGATGATGGCGGCGAGCTGGCGGACGAGCGGCCTGCGTTCCC
AATGGTGACGGCGCCCCTGGCCCAGCCTGAACGGGGCAGCATGGGCAGCCTGGACCGGCT
GGTGCGGCGCTCGCCCTCAGTGGATAGCGCCCGCAAGGAGCCGCGCTGGCGGGACCCTGA
GCTGCCTGAGGTGCTGGCCATGCTGCGGCACCCCGTGGACCCCGTGAAGGCCAATGCGGC
CGCCTACCTGCAGCATCTGTGCTTTGAGAACGAGGGTGTCAAGCGGCGTGTACGGCAGTT
GCGGGGGCTGCCGCTGCTTGTGGCACTGCTGGACCACCCGCGGGCTGAGGTGCGGCGCCG
GGCCTGTGGGGCACTGCGCAACCTCTCCTATGGCCGCGACACTGACAACAAGGCCGCCAT
CCGGGACTGCGGTGGTGTGCCTGCCCTGGTGCGCCTGCTGAGGGCTGCCCGGGACAACGA
GGTCCGTGAGCTTGTCACTG
gtgagtgggacctggccatgctcacatcccctgggaagagaagagtgtgaggctcaaccc
gggaggaacgaggccactcggcctgcgaccgcctgggaaagcacccggtaggcaggagtg
cagctgctgagacgcttgccccaggagccaggcatcaggcccagacactgtgacaggttc

 4.06 Intr +  38735  38854  120  0  0   84   80    48 0.974   5.24
tgcagtggtggggcttgtgccttgtgagagctgagggacaggtagggtcaccgtgtctct
gtgaggccctgtggcctcaggagtgttagtgccacctgccacatggcagggaatgggtgg
gacgggacagcactgccacaccctcctctgcacctcctcccctttggggctccttcctag
CTGGAAACCAGTACTGGGTGTCCCCCGGAACCACTCACGGCTTTTGTTACTTCCTACTGT
TCTGCATGAGCTGGGACATGAGGAGAGTGGGACAGGTCCTGAGCGTGGCCACCTGGGGAG

gtaggcaggcggtgcatatggtcagcacagattggccaatcgcaccccacaggcaccctg
tggaacctgtcatcctatgagcccctgaagatggtcatcattgaccatggcctgcagacg
ctgacccacgaggtgatcgtgccccactcaggatgggagcgtgagcccaacgaggactcc

 4.07 Intr +  38907  39090  184  1  1   43   48   317 0.858  23.25
cttcctagctggaaaccagtactgggtgtcccccggaaccactcacggcttttgttactt
cctactgttctgcatgagctgggacatgaggagagtgggacaggtcctgagcgtggccac
ctggggaggtaggcaggcggtgcatatggtcagcacagattggccaatcgcaccccacag
GCACCCTGTGGAACCTGTCATCCTATGAGCCCCTGAAGATGGTCATCATTGACCATGGCC
TGCAGACGCTGACCCACGAGGTGATCGTGCCCCACTCAGGATGGGAGCGTGAGCCCAACG
AGGACTCCAAGCCACGGGACGCCGAGTGGACAACTGTCTTCAAGAACACGTCGGGCTGCC
TGAG
gtgtggaccagacctggtgctaaagcccacatgcacaccaggccccgtcctcgtggtccc
agatagtgtggaagatggcggcgagcttaggagcgccagagcttaggagcttcagagctg
tggcacaagtcctgtggatgagaagtggggcctgatggagctgtcctcacccccaagtgg

 4.08 Intr +  39912  40029  118  0  1   70   86   181 0.986  17.74
cctgggggcagttagcttctcccccttcactgagctccagactgtggggtcctttcccat
tagtgctaggagggcagcagcagggcctattttgcagatgaagacaagcccacaaggcca
gggtggagccagggagtttctggtagccaggggtcacctggcctgctcttggccacacag
GAATGTGAGCTCCGATGGTGCTGAGGCCCGGCGGCGACTCCGGGAGTGTGAAGGGCTGGT
GGACGCGCTCCTGCATGCCCTGCAGTCGGCTGTGGGCCGGAAGGACACTGACAACAAG
gtgggcagggacggtcacagcctcataccaagggctggagagacgatcatgcaggtccca
ggaggctggaactgtgggagcagcacaggggaatgggcttgtgggtctggggtggcgttc
tgggtgtggcccgcctcgcagtgaccacactgaagtgggcaccgtcctgcaggcagaagg

 4.09 Intr +  40401  40572  172  2  1   88   98   290 0.992  30.72
ggcagaggcttcctcccatggacccttcctggcggttaccgcccttttgctcccctccac
tgaggactccctgttcctttgctcccggtgccctcatgcacaccagctgtggccagtctt
tcctgagggccagccctgtgcctagggtgccctgccccacccactcacctctccctgcag
TCGGTGGAGAACTGCGTGTGCATCATGCGGAACCTGTCCTACCACGTGCACAAGGAGGTG
CCCGGGGCCGACAGGTACCAGGAGGCCGAGCCCGGGCCCCTGGGCAGTGCTGTAGGCTCC
CAGCGCCGGAGGCGGGATGATGCCAGCTGCTTTGGAGGCAAGAAGGCCAAAG
gtgggtggggcggactggggtatcatctctaccatctcaactcctgccccagcggaaggc
tctctgtacacccacagcagcccatcatggaggctagaggacacctggtcagcccccaac
aggcaggcagggaagccaggagtcaaggaggctggactgccctgggtcacatggttgatg

 4.10 Intr +  41264  41419  156  0  0  101   75    24 0.682   3.57
cttcttgtacccctggtgggtgctcagtgcccagaagtgatgggatgaggttccacatgc
tgcctgcttgatccagggtgtgcagtgggaacctgaggcttccgggagggcatggggggg
tgatgagtgctgcctgttcaggctcctctcctctctcctctgcttcctccggcctcccag
AGGAGTGGTTCCACCAAGGTGAGTCCCTTTTTATCCTGCTCTCCAGGCCTGGCGTGTGCA
GTGGGTACCTGGGAAGAGGCGAGCACGTTCCAGCCCCAGGGCCCTGCCCCACCCCTGGCT
TCATCACTCGGGCTGCCATCTTTATGACAGTGGCAG
gtgggaaggccacggggctcattctgtaacctcagacttgcctacctgggcagagttggg
cagagccaagagtgggcagggcccgggggtacttatctctaggggcaccaaggagcagtc
tgtttctctgatagaatggggcatcatgtggctcggagggatacaagggtcccatgaggg

 4.11 Intr +  42230  42301   72  0  0  135  113   112 0.984  18.93
acccctaggctaaactgtctgcccaaactctgacaacggtgctccactcccacaggtgcc
caggcctggacatgggggtgccttttggggcctgggtaggagagaactgtgcccaactct
cctgatacacccattccccatatggggtctgcctcacctcccaccacctttcccttccag
GAAAGAAGGATGGTGAGATGGACCGGAACTTTGACACGCTAGACCTGCCCAAGCGAACTG
AGGCCGCCAAAG
gtgagtgggctgagatgaagccagctccactgggggatgtctgggctcaggattgccctg
gtagtgaagctttgagccatcaagcaggcctggagggcctcagggaacagatggggaaac
aggcccctaggtgcaggatttcctggagggtgattcagcaccaggacacctgctgagggt

 4.12 Intr +  43748  43875  128  0  2   33   77   234 0.691  18.38
tgggaacgcttttccccttgggtgactatatgttgatagtaaatattacgtgactcatcc
acacccatccctggccccagctcacccacgccctgggagctctgaagcgggaagcgggag
gggtatgatggatgagagcagattctgggtgaccgtgggtggcggttgccctgcacctag
GCTTTGAGCTGCTGTACCAGCCCGAGGTGGTACGTCTCTACCTCTCCCTCCTCACGGAGA
GCCGGAACTTCAACACCCTGGAGGCTGCCGCCGGCGCTCTGCAGAACCTCAGTGCCGGCA
ACTGGATG
gtgagggaccaggtcgggcagggtgggcaagtcctgagagagggaatcccaggcacctca
ctggtgcagctcctgcctcggctggcggggaaaggaggggccacaccaccaccccaggat
ccaagaggtgtatgggctgcgggcaatgcgtgcaccctggacggtgggaaaacctcggtg

 4.13 Intr +  44194  44344  151  0  1  106   85   351 0.999  37.52
gcgggcaatgcgtgcaccctggacggtgggaaaacctcggtggaggtgccgttgagcttt
tggggtagggctttgtcgggcacgggagcaggaaggtccagctggagagagcggtcagcg
tctggaggtgggagagtgcctggcatgtatgtctgagcaaccctctccccgcctccgcag
TGGGCCACGTACATCCGCGCCACAGTGCGCAAAGAGCGCGGGCTGCCGGTGCTTGTGGAA
CTGCTGCAGTCTGAGACCGACAAGGTGGTGCGCGCCGTCGCCATCGCTCTGCGCAACCTC
TCGCTGGACCGGCGCAACAAAGACCTCATCG
gtgaggacgcctgcaaagcccacgcctgggcaccgaactgtgcctgcagctttggggtcc
catcggaggggcttggaggatgagtggtttgggagtccaggccccggccctctcgcttgg
gcgctgtcccaactggaggtagctccagtccccccggccctgtctctgaagctcagcgcc

 4.14 Intr +  44670  44868  199  1  1   84   64   314 0.996  28.22
cagtccccccggccctgtctctgaagctcagcgccctgctcacaggggctcctgtgaccg
cctgcacacaggcggtctccaggggctctcctggcagtgcccctcgccctcgcgggatcc
ctgctccttcctggagaggtggggcagaggtgtgttctgacacctagtcctgcccctcag
GGAGCTACGCCATGGCTGAGCTTGTGCGGAATGTGCGCAATGCACAGGCTCCGCCGCGAC
CGGGGGCCTGCCTGGAGGAAGACACCGTGGTGGCGGTGCTCAACACCATCCACGAAATCG
TGTCCGACAGCCTGGATAACGCGCGCTCGCTCCTGCAGGCACGCGGGGTGCCAGCGTTGG
TGGCTCTCGTGGCCTCCAG
gtgtggaggggcggggtcggtggcttggggagccgcggaggtgggggaggggccaccact
gaccccgcccccggccccacagccaatcggtacgcgaagcgaaggcggcgtcacacgtgc
tgcagacagtgtggagctacaaggagctgcgtggtaccttgcagaaagatggttggacca

 4.15 Intr +  44951  45062  112  2  1   91   80   136 0.999  14.65
aacaccatccacgaaatcgtgtccgacagcctggataacgcgcgctcgctcctgcaggca
cgcggggtgccagcgttggtggctctcgtggcctccaggtgtggaggggcggggtcggtg
gcttggggagccgcggaggtgggggaggggccaccactgaccccgcccccggccccacag
CCAATCGGTACGCGAAGCGAAGGCGGCGTCACACGTGCTGCAGACAGTGTGGAGCTACAA
GGAGCTGCGTGGTACCTTGCAGAAAGATGGTTGGACCAAGGCGCGCTTCCAG
gtgcggcttccctggccttccttccattccctgctcactttgccttattcccactccatg
tgcttcacccaccctgtgtctgtgttttatgtctcagtcagctgctgctactgccaaggg
gcctaagggagcactgagtcctgggggcttcgatgacagcacgctgccactggtggacaa

 4.16 Intr +  45160  45250   91  0  1   81   97   156 0.999  16.53
cacacgtgctgcagacagtgtggagctacaaggagctgcgtggtaccttgcagaaagatg
gttggaccaaggcgcgcttccaggtgcggcttccctggccttccttccattccctgctca
ctttgccttattcccactccatgtgcttcacccaccctgtgtctgtgttttatgtctcag
TCAGCTGCTGCTACTGCCAAGGGGCCTAAGGGAGCACTGAGTCCTGGGGGCTTCGATGAC
AGCACGCTGCCACTGGTGGACAAGAGCCTTG
gtgagtggtggagcttagggagcctagagggtggcgaccccagctgccccagttgcctga
cccttgggtgaaggtgaaggaggagtcaggcctcccactgagacggcttccataggccac
tttccctgccctctgcctcttggctactcccttcccacagcatccgcgctgttgtcaagc

 4.17 Intr +  45576  45629   54  1  0  107  109    98 0.999  13.89
actcccttcccacagcatccgcgctgttgtcaagctggggtgaggctgccagctggcaga
ggttgggcaccttagtgacagagagcctctagggctacctgggccagccctgtgtgggct
tctctgccccgatcccccctggctgccacatgcagcccgtctcctcctcctgccttgcag
AGGGCGAGAAAACTGGCAGCCGGGATGTGATCCCCATGGATGCGCTGGGCCCAG
gtgagtgcagatgcagtgtggttggttttctgtgccgggaggggaccaaggcctgaagtg
ggcctgctggttttatggggtgtagatggtgctgggtggaggagagatatttggtttagg
ggtgcttagagggtgaggtacagggcagctagagagggattagtgctcagccaggggctc

 4.18 Intr +  46016  46101   86  0  2   82  106   103 0.504  12.20
agagttggcagggtgttggtgagagctggcaccagcctggatctccaggacagggtgggt
gggggctgtctcccaaagcccctgtcccacgagtcccctgtgtctgggctgagagggaga
tctgctcctacagggcctccctcagagcgcccctcatgccccaccttaccccatctacag
ACGGATACTCCACGGTGGACCGGAGGGAGCGGAGGCCACGGGGCGCCAGCTCTGCAGGAG
AGGCCTCTGAGAAGGAACCCTTGAAA
gtaagtggtcatgtggctgtgggcaggtccccggtgaggccccgtgtctaggggttgctg
gagagcagcctaggccatgctgggtctggtctgggccctggggtacagctgggttgtggg
gccaagcccaggaagcagccccttcacgccagtcagtctgtgggtactgacaagtttgca

 4.19 Intr +  46882  46938   57  0  0  113   55    21 0.666   1.52
caggctggtggacgccgtaggggacgctaagcctcagcccgttgattcctgggtctagct
tgcatgcctggtacgttctctcatctggttgttcgtccacctgttcctgccctctgggcc
agggcttcttgttagtctccgctgcctgcacgctctgctcttcccgcacgttccccgcag
GACTTTGGCCTCCAGTCCAGCAGCCCAGTGGCCCATTCCCGGAAAGACCAGGCAGAG
gtcagagagggagggtgctccctgggcccacagccctgtcccaggcactgtgggatcagg
ggcctgaggaaatgggaccagagtagggatgggcaccataccctccaacgcccttcgggg
accagcaagtcaggatcagccctggtgccaagacccttggggtcagcccacaccacccag

 4.20 Term +  47851  48015  165  0  0    8   42   139 0.599   0.17
gacttctaaaggcggagggtctccctgggcaccctgcaggcaggcagaccacggtgtggg
gggtgccccacaaggcccagccctgggcaaggaagctttggaagcagcaaggtgggggtc
aggctacaggtgccccacctccccagagccctgcagtcacgtgaggcccctgtgcagtag
AGAGCCTTTCTCCAGCCCATGCTGGCTGGGGCCGGGGCTGCCGCATCTGCCTGGAGCCTG
GGCAGCACCTCCGGGACTGACCTTCGGCAGTGGCTGGGGGACTGCTTTCAGTGCCTGCTG
TTCGTGACTCAGAAACAGAAGAAAAACACTGAGAAAAAGCATTAA
aaataagccaaaataagactattggtaaacacctaaatttttgtaagaaaatttaaaaat
taaagcagcaaaggaactttttgctttctgccactcaggtctggcacaagtggctggctt
ctcccttgtgtcgggcctctgcgcgtctggggcagggccctgggtggaggtggtcccagg

Predicted peptide sequence(s):


>ARVCF_1|GENSCAN_predicted_peptide_1|331_aa
MTCLRTGTEGAQGGVGRGTQAGGPGGAPSLTPEAAGAARREDTSGPSVPLSFPAARCPRK
VPGLPPLGLLESFGGCRALAARRQASRGAGTAAGSGRARLECSVQDARTGPARNPRPRAS
PPALTRPVRKADRAGDANLRPAPSDSKFSHWSRDPARHGNRRRLGGCAEMTACHWASGMS
VPADDRPPRGGAAAPHLPEPLRRRWQGTRDRSLPADLREHPPTIQPRAGTGRAGAPSPDS
GRVASATTPSSQVSFFSACYSLRAARRSLLSTSNCILHASREREFCCYPHFTVGKQPQRG
SHLLEHSRLTLGPGGSLILTPLGPRSGETME

>ARVCF_1|GENSCAN_predicted_peptide_2|51_aa
MVNSIRHADKEPWQPSVTYSPGHVGARRSQSLQGGCRDMLIFPQDRSCSVI

>ARVCF_1|GENSCAN_predicted_peptide_3|101_aa
MDIGHVPKGIQDQDVSLQVLSQDKLLGKQPTHSAPNDEHEVCRSVERCSALLSGPDIGGG
GWPIASTAYRDGHPPRKKNGQKPPQQEYVQRGYQRQGWNLS

>ARVCF_1|GENSCAN_predicted_peptide_4|1110_aa
MLTVLRAVWPRGYALPTVLAGALVMEDCNVHSAASILASVKEQEARFERLTRALEQERRH
VALQLERAQQPGMVSGGMGSGQPLPMAWQQLVLQEQSPGSQASLATMPEAPDVLEETVTV
EEDPGTPTSHVSIVTSEDGTTRRTETKVTKTVKTVTTRTVRQVPVGPDGLPLLDGGPPLG
PFADGALDRHFLLRGGGPVATLSRAYLSSGGGFPEGPEPRDSPSYGSLSRGLGMRPPRAG
PLGPGPGDGCFTLPGHREAFPVGPEPGPPGGRSLPERFQAEPYGLEDDTRSLAADDEGGP
ELEPDYGTATRRRPECGRGLHTRAYEDTADDGGELADERPAFPMVTAPLAQPERGSMGSL
DRLVRRSPSVDSARKEPRWRDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEGVKRRV
RQLRGLPLLVALLDHPRAEVRRRACGALRNLSYGRDTDNKAAIRDCGGVPALVRLLRAAR
DNEVRELVTAGNQYWVSPGTTHGFCYFLLFCMSWDMRRVGQVLSVATWGGTLWNLSSYEP
LKMVIIDHGLQTLTHEVIVPHSGWEREPNEDSKPRDAEWTTVFKNTSGCLRNVSSDGAEA
RRRLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIMRNLSYHVHKEVPGADRYQEAE
PGPLGSAVGSQRRRRDDASCFGGKKAKEEWFHQGESLFILLSRPGVCSGYLGRGEHVPAP
GPCPTPGFITRAAIFMTVAGKKDGEMDRNFDTLDLPKRTEAAKGFELLYQPEVVRLYLSL
LTESRNFNTLEAAAGALQNLSAGNWMWATYIRATVRKERGLPVLVELLQSETDKVVRAVA
IALRNLSLDRRNKDLIGSYAMAELVRNVRNAQAPPRPGACLEEDTVVAVLNTIHEIVSDS
LDNARSLLQARGVPALVALVASSQSVREAKAASHVLQTVWSYKELRGTLQKDGWTKARFQ
SAAATAKGPKGALSPGGFDDSTLPLVDKSLEGEKTGSRDVIPMDALGPDGYSTVDRRERR
PRGASSAGEASEKEPLKDFGLQSSSPVAHSRKDQAERAFLQPMLAGAGAAASAWSLGSTS
GTDLRQWLGDCFQCLLFVTQKQKKNTEKKH