GENSCAN 1.0	Date run: 16-Jan-104	Time: 03:34:38

Sequence U2AF1_1 : 16967 bp : 44.90% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1088   1274  187  0  1   42   89   222 0.763  16.45
gcccccagtccccggcgcgcaggatccagcagggccagcgccgggcgggcgagaaggcga
gagagctagggccgggcggggagggcaccggcagggggcgcgggttcccaggaccgaaaa
ggcggagcctcccacgcgcactacgtgctccctacgcgcatgcgtcccgcccacgcgcag
GCAGCACCTCGCCTGACTGGGTAGCGCTGCCACGTCGGGGCGGGGAAGAGCGTCGTCGCG
TCCGGGTGACGTCTCCCGAGGGCGTCGGCAGGGTCGGCGGCGTCGGCAGCAGTGTCGACG
GCAGCGGCGGCGGCGGGTGGGAAATGGCGGAGTATCTGGCCTCCATCTTCGGCACCGAGA
AAGACAA
gtgagtgggagccccccgccgggggttgggcgcgatcggggcgcagggtggttgaggcgg
tgggagggcgaccggggaggcccaggcgggccggcgcggcggtggcgggggaggggcgcg
cggcgggaaggagcggtggcccttccggccccttgcgcgccctccggagccgccgcctcg

 1.02 Intr +   1580   1700  121  2  1  -18   41   154 0.529   0.60
ggaaggagcggtggcccttccggccccttgcgcgccctccggagccgccgcctcgtgggc
cgcgcggcggaaaactggagcgggcagaatgaatggggtctcttttcggggcgccgcggc
cgagctttctccggccttggggtccggactggctgatcgcccgacgtccgggcctccgag
TCGCCGACTCCCGGAAGCCGCCTCGAGCCGCGCTGAAAGTTGCCTGGAGCATCCGGGCCT
TTTGGACGTGGACACGTTTGTTCCAACTTTCGGCTGTGAATGTCCTGTCGAGCAAGCTCT
G
gtaccagcctcgccagtattcagtcgcttatctaacttagggtcctaagcgttggtgttt
tatccacttagccagcctcttgcctgtttaagcgaccgctgggccggcagtaaggagata
tgacgagaaaaagtatggtggagactactggattaactatctaaccacaagagacgtgat

 1.03 Intr +   7293   7359   67  2  1  113   93    11 0.705   2.58
actgctcaaactctgttttcataatatgatggttttggtgtactcttcagaagacaaatg
tctgacttgcgggaaaaaaacaaacgtttagccatttgcaaacaaattgtctctttgcaa
ttgtctaatatatgcacagcagccagtagaattcccctttttatttttttttccccgcag
ACCATCTTGATTCAAAACATCTATCGTAATCCCCAAAACAGTGCACAGACGGCTGACGGC
TCACACT
gtaagtcccacagttggagaaatttttttaaaacaatggtgttaaagagcccactcttaa
ttgagacaaataatgttggcttctgagctgctgacatagagctgttgcaaacaggacaag
gtgctggaactccttggcgcacacagcaagaacttgatacttggccacgttcaggaggct

 1.04 Intr +  12982  13031   50  2  2  118   78    51 0.981   5.50
acacttgacaccattcacaagtagccatgtggctcagtctcctgagtgctcctgcagagt
gcagctctgccaggcttttctctagataatctcgtgtgtgttactgtagcagtttgagtt
taaacacaagagttcactcggttaacatgttctaaccagcaagatttctgttgtttgcag
GTGCCGTGAGCGATGTGGAGATGCAGGAACACTATGATGAGTTTTTTGAG
gtgagagaactgaactctgtgactgatagacctgttgatcttctgtatctgtttggaagg
atttaaaatgtttctctgctaataaacatacatgagttatatctaatgacactttgtaat
gtataacgagtcttaaaccactgtggtctcccttcaggaggtttttacagaaatggagga

 1.05 Intr +  13189  13287   99  0  0   81   97   174 0.991  17.91
aacactatgatgagttttttgaggtgagagaactgaactctgtgactgatagacctgttg
atcttctgtatctgtttggaaggatttaaaatgtttctctgctaataaacatacatgagt
tatatctaatgacactttgtaatgtataacgagtcttaaaccactgtggtctcccttcag
GAGGTTTTTACAGAAATGGAGGAGAAGTATGGGGAAGTAGAGGAGATGAACGTCTGTGAC
AACCTGGGAGACCACCTGGTGGGGAACGTGTACGTCAAG
gtaggagccagggcgagacggcggcgtggccgcttagtgtgccagggccaaggccaacag
gcgaaagcgagacagtggtgcagccgcttagtgtgccggggccaaggccgacagaggatg
gggtgcctgtcgccatgcaccttgagatcctggatgctcaggcgcacagcagggctcagg

 1.06 Intr +  13937  14070  134  1  2   87   84   234 0.999  22.34
aatcttggactatcttgaagttaatctcattgaaaataaaggatttttcaattatcctgt
aatactattccaccttactatacctgagtgtgtatatctctctctgatatacttggattg
gtaattgagaaagtcttattaaagcgtggatggcaagcacttctgtttttgtcttttcag
TTTCGCCGTGAGGAAGATGCGGAAAAGGCTGTGATTGACTTGAATAACCGTTGGTTTAAT
GGACAGCCGATCCACGCCGAGCTGTCACCCGTGACGGACTTCAGAGAAGCCTGCTGCCGT
CAGTATGAGATGGG
gtgagtgaggagtggccagtgacgtgactgagcacagttcggggccgtgtgcacacgagg
tagtaaatgtctccttccaacccacccacagagaatgcacacgaggcggcttctgcaact
tcatgcatttgaagcccatttccagagagctgcggcgggagctgtatggccgccgtcgca

 1.07 Intr +  14162  14254   93  2  0   60   81   123 0.845   7.88
aaccgttggtttaatggacagccgatccacgccgagctgtcacccgtgacggacttcaga
gaagcctgctgccgtcagtatgagatggggtgagtgaggagtggccagtgacgtgactga
gcacagttcggggccgtgtgcacacgaggtagtaaatgtctccttccaacccacccacag
AGAATGCACACGAGGCGGCTTCTGCAACTTCATGCATTTGAAGCCCATTTCCAGAGAGCT
GCGGCGGGAGCTGTATGGCCGCCGTCGCAAGAA
gtgagtattcctgtgcccgttgttaagctcagtggcttctttctcccctcacaaccctcc
cccttccaaaaaaaaaattttggcataggtgtcgtttctgttttttaaaaggcagtgctt
agaacatagtacatatttttaaatatccaaatgtcctctttggagaagaatattcacctg

 1.08 Term +  15476  15623  148  2  1   93   52   103 0.782   4.57
aaacttttcacacctgaaatcagggtgtgtctcagtcacggcgtgcagtctcttcagcag
tgtttttccttatcagtgccgttggcttgaggagctgcgcgtgttgagagagtgggtgtg
gttctgtgctgcgtgccgtggtttggatggcacggttttctttattttccttggttgcag
GCATAGATCAAGATCCCGATCCCGGGAGCGTCGTTCTCGGTCTAGAGACCGTGGTCGTGG
CGGTGGCGGTGGCGGTGGTGGAGGTGGCGGCGGACGGGAGCGTGACAGGAGGCGGTCGAG
AGATCGTGAAAGATCTGGGCGATTCTGA
gccatgccatttttaccttatgtctgctagaaagtgttgtagttgattgaccaaaccagt
tcataaggggaattttttttaaaaaacaacaaaaaaaaaaacatacaaagatgggtttct
gaataaaatttgtagtgataacagtattcttggtgtaacttatttcttgtggaagttctt

Predicted peptide sequence(s):


>U2AF1_1|GENSCAN_predicted_peptide_1|299_aa
XSTSPDWVALPRRGGEERRRVRVTSPEGVGRVGGVGSSVDGSGGGGWEMAEYLASIFGTE
KDNRRLPEAASSRAESCLEHPGLLDVDTFVPTFGCECPVEQALTILIQNIYRNPQNSAQT
ADGSHCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRREE
DAEKAVIDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISREL
RRELYGRRRKKHRSRSRSRERRSRSRDRGRGGGGGGGGGGGGRERDRRRSRDRERSGRF