GENSCAN 1.0	Date run: 16-Jan-104	Time: 03:31:58

Sequence TMPRSS3_1 : 26600 bp : 50.88% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1875   1968   94  2  1  111  111    27 0.816   6.20
tggttaatcgatactgaatgcgctttgtgtggactgtcgaatttcaaagatttaccgtat
gaccaagatgcacctgatgctacaagtataaataggggaacaaatgctttctgttcttcc
tcggctaaggaggtagaggtggaggcggagccggatgtcagaggtcctgaaatagtcacc
ATGGGGGAAAATGATCCGCCTGCTGTTGAAGCCCCCTTCTCATTCCGATCGCTTTTTGGC
CTTGATGATTTGAAAATAAGTCCTGTTGCACCAG
gtaagtggacccaggtgaggactctgtgatttctgcccataccctcatgtaggtgaccaa
tgtgactgactgtccctgtgggggaaatatctccccagccattctgacacccacaggctg
gacacctgcacttccctagatctgcagaatctcagggagaaggggcattggagaggggat

 1.02 Intr +   7255   7365  111  2  0  114   73   117 0.994  13.15
aggactgaactagagaatgtgccccttggtgggtggccctttccctaattaaggcacctt
tctttgggctgagacttctctgcaaagaggggagggggaaaggatagttaaatttgtaag
tttcatggcactccaagtcaggttctgtggctttctgctcttcctttttctggttttcag
ATGCAGATGCTGTTGCTGCACAGATCCTGTCACTGCTGCCATTGAAGTTTTTTCCAATCA
TCGTCATTGGGATCATTGCATTGATATTAGCACTGGCCATTGGTCTGGGCA
gtgagtacaattcattatttagtaggatctcaaatacctagccaagtagttaaactttca
tgagcgccccctctcatcccagcattttgctgctgcccagccttaattactggaggcaaa
catccttttggtttgctgacttgaagttttatttgcccacatgaatgtaaagtcagtctg

 1.03 Intr +   8247   8363  117  1  0   92   79   206 0.996  20.54
accccttggaattcaaaacagaaactgggctgcaggaaacaggctgctgacagggacgca
atttcaatacaggtttcattattcacgggccagctccgcactgtgtggcagggggacagt
tgttagtgttgcactctgaaagagctgttggttaattcctgccttcctcccttttcccag
TCCACTTCGACTGCTCAGGGAAGTACAGATGTCGCTCATCCTTTAAGTGTATCGAGCTGA
TAGCTCGATGTGACGGAGTCTCGGATTGCAAAGACGGGGAGGACGAGTACCGCTGTG
gtaaggtcatggctcttcccctggggaaacagaaggaagcagcagaagccaaccctgacc
cttcccatctgtaaaatgggtccaagtcattgccatttttaggtcatgtcttcagctggg
attgaactggcgtttgcccaaagacatgttgggctggggggtcagggagggccttccatg

 1.04 Intr +   8766   8889  124  1  1   38  115    79 0.968   5.24
agaccagcgagaagtctcagggatccagagtcactgctctgtgatggggaggctgccgtg
gacaagaagtgggtcagatttggcagaggaggggtttgagctggctgtggagaaacccct
gcctatggtctcagggttccactggccactaataagcctttctttctgcacatcggccag
TCCGGGTGGGTGGTCAGAATGCCGTGCTCCAGGTGTTCACAGCTGCTTCGTGGAAGACCA
TGTGCTCCGATGACTGGAAGGGTCACTACGCAAATGTTGCCTGTGCCCAACTGGGTTTCC
CAAG
gtaagttaaagagcatttccaacccatgggcaaaacacagagaggataacaataaagaaa
gacaactaccatttagttgggcactattgggtgctttaacgctctcagattacatcctca
catccaccttaggatgcccgatatcatcctcacttcacaggcaagcaaaccaaggccaga

 1.05 Intr +  11183  11293  111  2  0   48   94    41 0.497   0.19
gaagaaatcctgttgataagctggtgtgttcactatgaaaacaagcctactgtactgtgt
tttgttcatttcacaagggaaggagaacatggctgtttattcaccatcttccatcttgtg
actctccaaacatgtgattcttctttaaaaagttgcatcactttcaccactgttctccag
AAGACCTGTGTCCTGGCACTGTAAAAATGAGCTGGGCTCTGGTGTTCGTGGAATCGCTTT
CTTGTTTGTGTTCATCTCTTTCCAGTGGGGCTCTGCGCTGGTCCTGGGCAG
gtgagggatgtctctcctgttcctccaactcactgttcttggagaacttggtgtccctgc
ttgggtgccccccgacaatactgcacctagttttgtgctcacctcccctctggacttgct
tcaggccaagcaaaaggcatttcactggaatgcgcaaagagtgactcaaccaaggacata

 1.06 Intr +  11758  11883  126  1  0   62   92    77 0.922   5.29
gaatgccttgccagggtgagtgaacttcattctcttggcaaaggaagcctttgatgggtt
tggggggacaaaatgacatcccccatgtacaatccctgtaatattgtgactcgcacatcg
gttgaatgcttcaaagtgtaaagttaccacgtcgggtctgtctttccaatgtgcttgcag
CTATGTGAGTTCAGATAACCTCAGAGTGAGCTCGCTGGAGGGGCAGTTCCGGGAGGAGTT
TGTGTCCATCGATCACCTCTTGCCAGATGACAAGGTGACTGCATTACACCACTCAGTATA
TGTGAG
gtaggtggtcaggcgatgctgttgtctgcacaggtatcgagtcacctgctggatttgtga
tgctatgcacaactccacaaggacttaagaggcatgcatgtgttatctcagatggaaggt
gggagttggccaccttgatgagactggtggatgcgccaggctgggggtgtgagaacctga

 1.07 Intr +  15058  15227  170  1  2  125   43   187 0.993  17.49
tgtgtttctgtagggcgtggcagtgcagttgcatatacagcataaacaagcagggtgatg
ggaccacatcttgcctgataacctctcccaccatcttcctaggttttcaggatacctgag
gtcaatgagttcagtggttggacttttcctgtgcttcacctcttgctcttctcatttcag
CTTGTACCTCCCCAAGTCATGGACCATCCAGGTGGGTCTAGTTTCCCTGTTGGACAATCC
AGCCCCATCCCACTTGGTGGAGAAGATTGTCTACCACAGCAAGTACAAGCCAAAGAGGCT
GGGCAATGACATCGCCCTTATGAAGCTGGCCGGGCCACTCACGTTCAATG
gtacatctgggtctctatgtggttctgcagctcttcctttgtttcaagaggatttgcaat
tgctcattgaagcattcttatgatggctgctttataatccttgtcagatattaataattc
caactcctgattcatgttggtgttggcatcagttgattatcttttctcattaaaattgtg

 1.08 Intr +  16696  16827  132  2  0   56   75   108 0.973   6.92
gggaggcccacaggatccagccctacacacaggcaaactcgtcgcctccagatatcccag
gaaccatagcaatattcatggagccgtgttctataggcaacacccacactgtgatctagc
caggagtgggcacgcgttggcctgagagcctggtctgccccatcgtgttttggtaaatag
ACATTTTACTGGACACAGCCACACCTATGTGGGTACCTGTTACCTGGGGCTGTCTTCATG
CTCCAATGGCAGCCAGAGACCGCACAGCCCACGAAGCCTACAACATTGACTATTCAGCCC
TTTCCACAAAAG
gtgtgctgaccctggtctaggttccctcacgctgcgacggtggagggctcttttacagtt
ttaagtgctctgggtgtggtggatggggtaaggggctcctgctgtgagctgatcgttttc
aagtaaccaagggcttgaccttccttcccttgggagatagtttgggctcctcagaggcag

 1.09 Intr +  17077  17175   99  2  0   61   78    64 0.629   2.78
ctgggtgtggtggatggggtaaggggctcctgctgtgagctgatcgttttcaagtaacca
agggcttgaccttccttcccttgggagatagtttgggctcctcagaggcagaagcataga
tgagattgttttctcggactcctgcttcaattgagttgtgaactattgtttcccttcaag
CAGAAATGATCCAGCCTGTGTGCCTGCCCAACTCTGAAGAGAACTTCCCCGATGGAAAAG
TGTGCTGGACGTCAGGATGGGGGGCCACAGAGGATGGAG
gtcagtgggctgaagccaagattcggagtccaggggctcagaacccagagggctgcggag
ggggctcccccaatgtcccattgtgatgttcccatgggctgcccagataccccggccagg
gagtgcatgtcagctgctcgggacacagtcagccaaggaactgtgggtcaggagtcacgg

 1.10 Intr +  20609  20751  143  0  2   40   96   180 0.493  14.07
cgagacagtgggagtctgctcgtcccacccgcagggccctgtccttttccgctgttgcga
cacaccagagagcatccccctcgtccctcgttccctcacccccctggtctcagcatgcgc
cttctgtgttttgggccgggcttccttctcacacacatcccctcactcactttgaagcag
GTGACGCCTCCCCTGTCCTGAACCACGCGGCCGTCCCTTTGATTTCCAACAAGATCTGCA
ACCACAGGGACGTGTACGGTGGCATCATCTCCCCCTCCATGCTCTGCGCGGGCTACCTGA
CGGGTGGCGTGGACAGCTGCCAG
gtacggggccgcagcggtgggcgaggccgtggcagggtgacccagcccttgggacaggtc
gttgccagcgtttccctgtgacaggacaaaaagtaaatttacagggcgtggagaagaaat
ttgctcaagatatcactccttttcctggctgccagccctgtgtttacccagtgatctggc

 1.11 Intr +  21424  21576  153  0  0   97   90   160 0.919  17.37
gggatgctgtgtctggaagggctggtgggttcccttctgtaacctgggtcatccattggg
acatcatgaaggggggtcccaactccatagcaagcagcctcacacggcagactgtccaca
gaaagcaatctcgcatggcggtgactgtcccccaatctttgcttctttcctgtcacccag
GGGGACAGCGGGGGGCCCCTGGTGTGTCAAGAGAGGAGGCTGTGGAAGTTAGTGGGAGCG
ACCAGCTTTGGCATCGGCTGCGCAGAGGTGAACAAGCCTGGGGTGTACACCCGTGTCACC
TCCTTCCTGGACTGGATCCACGAGCAGATGGAG
gtgggtgcggcgccctccccagctcacgttgtccctggcttttgaccctaaggtccctta
aatgcaaccctggtcttgctataaaaaccagggcgtgacccagtggttgtcaattcagca
gcagtgacttggtggctccagggtgtcagacgcttgtgctgaaaacagagatcacagcta

Predicted peptide sequence(s):


>TMPRSS3_1|GENSCAN_predicted_peptide_1|460_aa
MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFPIIVIGIIALI
LALAIGLGIHFDCSGKYRCRSSFKCIELIARCDGVSDCKDGEDEYRCVRVGGQNAVLQVF
TAASWKTMCSDDWKGHYANVACAQLGFPRRPVSWHCKNELGSGVRGIAFLFVFISFQWGS
ALVLGSYVSSDNLRVSSLEGQFREEFVSIDHLLPDDKVTALHHSVYVSLYLPKSWTIQVG
LVSLLDNPAPSHLVEKIVYHSKYKPKRLGNDIALMKLAGPLTFNDILLDTATPMWVPVTW
GCLHAPMAARDRTAHEAYNIDYSALSTKAEMIQPVCLPNSEENFPDGKVCWTSGWGATED
GGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLTGGVDSCQGDSGGPLVCQE
RRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWIHEQME