GENSCAN 1.0	Date run: 16-Jan-104	Time: 02:58:34

Sequence TCP10L_1 : 11354 bp : 49.54% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   2271   2546  276  2  0   64   81   210 0.280  13.32
ccggctcacaccccactcacacccctctttggatgactggagtgtgttaggtgtcaggct
gatcttctaggatctaaagcattttccacggaggatggtggagagccaggtgtggacagc
tcagtccctctgtctgtggtgtcctttcacctggtcagcttcgggcctgggaatgtgcac
ATGACCCAGGGGGAGAAGGAGCGGCTGCGGGTCCTGCTCACCCTTAGTTTGGGGCTGGGG
CCTTCAGCCCACACTGACGGGGTAGGAGGGCTGCATTCAAGTGTCCCCATAGCCCTTCCC
TTCCCAACCAGGATGCTGGCAGGTCAACTCGAGGCCAGGGACCCCAAAGAGGGCACCCAC
CCAGAGGACCCGTGCCCAGGAGCTGGGGCTGTCATGGAGAAGACAGCTGTGGCAGCCGAG
GTTCTCACGGAGGACTGCAACACTGGGGAGATGCCA
gtgagttgagctctgtggggacagagttagtcccaccaggcgggaccctgattcctgtcc
ctgaggcccgtcattggactttcccttgctggacccctgtaggaatgcaccaccccggga
cactgattctgtacttcctctccaaggggcatgtggctctttccccctctgcaaccgtat

 1.02 Intr +   7876   8013  138  0  0   70   55    83 0.367   3.86
acaaacgcttggtgagggtttctgttcttatcaacatattagggggaaaacccagtccaa
gtccccctaccttgtaccctatttttttctaggacattccaattattcttcattgtatta
aaatttgaatttattttaccttcgaaaatgtgaagaatttccctgcattttgtcttttag
GCATTGGAACCTGCTTTTGGAAAAATTTCACCTCTGTCAGCTGATGAAGAGACAATACCC
AAATACGCTGGCCACAAGAATCAGAGTGCCACTCTCCTGGGACAAAGATCGTCATCTAAC
AATTCAGCTCCTCCAAAG
gtgaccctttgtgcttatcatctgtaaagagaagcagaggttctgtacccaaacacacac
atcccatcagctcctcaccacacaatttcacctccctgggtgagcatggtgctccctgga
gtcctgtgttcttccaaggacacgggtacatgcctttcaaacaagatcctaacccttagc

 1.03 Intr +  10384  10495  112  0  1   58   93    62 0.145   3.65
tctttaaaaaaattaacccaccttgtagtatggagtgtcgggctgttgggtgagccctgg
ggtcttgctggaaatcgaggatggctgaagatggctttgtgctcccagcctttgggctca
aggcattgcccgctccagggaccttgtgacaaggcgggcctgtgactgtcattgccccag
GCTATGCATCCATCTTCCCGAAGTCTGCAAAACTTGAGTGGCAGAAAATCACCAGTGCAG
GCTTCCCAGGCCGCCATGCTGCAGGAGCAGATGGCAGCAGCCGGAGGAGCTG
gtgagcagagttggggactcctgtttctatgctccccgtgaaatgcggggctttctcgtg
gatacgcgtgagcagaacatcttactatggcaaggacatgtccttcctggagctgcctaa
tttgtggccactttttgtctgattccctcgttgggtcctcacctgtgagacttgccaaca

 1.04 Intr +  10910  11124  215  0  2   95   64    36 0.100   0.33
ctggagattccgaatcctagcggtcacttccctctgagcacactcccagcagaaggcgtg
tggctggggctagatgcacttgggtgctttgttcccctttctccatttgccagcccatgg
cattgctgccaccctgatggagcgccctctcatctggcaccttcctggcctctttcccag
GCCCCAGTTCTGTCCATGCAGCTGTGGGTGCTTCCTGCATTGCGGGTCTCACGGGGAGGA
GACGAGAGTGCCCCTGGTTGAGTCAGGAAAGAATTCTATCTTCACGTCGCTGCCAGCAAA
TGACCACAGCAGCTTCACGACCTCTGCAGGAACCTATCTTGGTAAAGAAACGGGGCCTAT
GTGGTGGCCGAGCCTCAGGTGTGGCCGAGCTTCAG
gtgtggcccttatgcacagcacagcccaagcctgtgggcaccactcgccctgggctgcct
ggcacctggactccttcccatccttggccgaggtctgcgtggcccttcagggccgaatct
gacactgtcttcctcctgagtctgccccccgggcttcctgcccacccccaggctgtttca

Predicted peptide sequence(s):


>TCP10L_1|GENSCAN_predicted_peptide_1|247_aa
MTQGEKERLRVLLTLSLGLGPSAHTDGVGGLHSSVPIALPFPTRMLAGQLEARDPKEGTH
PEDPCPGAGAVMEKTAVAAEVLTEDCNTGEMPALEPAFGKISPLSADEETIPKYAGHKNQ
SATLLGQRSSSNNSAPPKAMHPSSRSLQNLSGRKSPVQASQAAMLQEQMAAAGGAGPSSV
HAAVGASCIAGLTGRRRECPWLSQERILSSRRCQQMTTAASRPLQEPILVKKRGLCGGRA
SGVAELQ