GENSCAN 1.0	Date run: 16-Jan-104	Time: 02:56:41

Sequence SOD1_1 : 11370 bp : 43.97% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1268   1477  210  1  0   64   40   112 0.359   2.79
agggggcgggctgagcgcgtgcgaggcgattggtttggggccagagtgggcgaggcgcgg
aggtctggcctataaagtagtcgcggagacggggtgctggtttgcgtcgtagtctcctgc
agcgtctggggtttccgttgcagtcctcggaaccaggacctcggcgtggcctagcgagtt
ATGGCGACGAAGGCCGTGTGCGTGCTGAAGGGCGACGGCCCAGTGCAGGGCATCATCAAT
TTCGAGCAGAAGGCAAGGGCTGGGACGGAGGCTTGTTTGCGAGGCCGCTCCCACCCGCTC
GTCCCCCCGCGCACCTTTGCTAGGAGCGGGTCGCCCGCCAGGCCTCGGGGCCGCCCTGGT
CCAGCGCCCGGTCCCGGCCCGTGCCGCCCG
gtcggtgccttcgcccccagcggtgcggtgcccaagtgctgagtcaccgggcgggcccgg
gcgcggggcgtgggaccgaggccgccgcggggctgggcctgcgcgtggcgggagcgcggg
gagggattgccgcgggccggggaggggcgggggcgggcgtgctgccctctgtggtccttg

 1.02 Intr +   5288   5384   97  1  1   70   94    64 0.478   4.78
cctagagcagttaagcagcttgctggaggttcactggctagaaagtggtcagcctgggat
ttggacacagatttttccactcccaagtctggctgctttttacttcactgtgaggggtaa
aggtaaatcagctgttttctttgttcagaaactctctccaactttgcacttttcttaaag
GAAAGTAATGGACCAGTGAAGGTGTGGGGAAGCATTAAAGGACTGACTGAAGGCCTGCAT
GGATTCCATGTTCATGAGTTTGGAGATAATACAGCAG
gtgggtgttgtgctgtgctggtgacccatacttgttcaccctagttagataaacagtaga
gtagcccctaaacgttaaaacccctcaacttgtttttgtttttgagaaagggtcttgctc
tgtcgctcaggctggagtgcagtggcgctgtgcgatcatggctgaccttagccttgacct

 1.03 Intr +   7947   8016   70  1  1   76   77    16 0.724  -2.46
tggccatagacttgtttctgttcccttctcactgtggctgtaccaaggtgttgcttatcc
cagaagtcgtgatgcaggtcagcactttctccatgggaagttttagcagtgtttcttttt
agaatgtatttgggaactttaattcataatttagcttttttttcttcttcttataaatag
GCTGTACCAGTGCAGGTCCTCACTTTAATCCTCTATCCAGAAAACACGGTGGGCCAAAGG
ATGAAGAGAG
gtaacaagatgcttaactcttgtaataatggcgatagctttctggagttcatatggtata
ctacttgtaaatatgtgctaagataattccgtgtttcccccacctttgcttttgaacttg
ctgactcatctaaacccctgctcccaaatgctggaatgcttttacttcctgggcttaaag

 1.04 Intr +   8756   8873  118  2  1   88  103   153 0.999  17.27
tctttcttcccagagcattagtgtgtagacgtgaagccttgtttgaagagctgtatttag
aatgcctagctacttgtttgcaaatttgtgtctactcagtcaagttttaatttagctcat
gaactaccttgatgtttagtggcatcagccctaatccatctgatgctttttcattattag
GCATGTTGGAGACTTGGGCAATGTGACTGCTGACAAAGATGGTGTGGCCGATGTGTCTAT
TGAAGATTCTGTGATCTCACTCTCAGGAGACCATTGCATCATTGGCCGCACACTGGTG
gtaagttttcataaaaggatatgcataaaacttcttctaacatacagtcatgtatctttt
cactttgattgttagtcgcggtttctaaagatccagataaactgtacttgcagttcaaat
taggaaaagcaattttattggacaattacggtgaaaatgaattattttatctaggtcagt

 1.05 Term +   9969  10076  108  2  0   83   41   124 0.998   5.71
caagaaaaagctttgagtagtagtttctacttttaaactactaaatattagtatatctct
ctactaggattaatgttatttttctaatattatgaggttcttaaacatcttttgggtatt
gttgggaggaggtagtgattacttgacagcccaaagttatcttcttaaaattttttacag
GTCCATGAAAAAGCAGATGACTTGGGCAAAGGTGGAAATGAAGAAAGTACAAAGACAGGA
AACGCTGGAAGTCGTTTGGCTTGTGGTGTAATTGGGATCGCCCAATAA
acattcccttggatgtagtctgaggccccttaactcatctgttatcctgctagctgtaga
aatgtatcctgataaacattaaacactgtaatcttaaaagtgtaattgtgtgactttttc
agagttgctttaaagtacctgtagtgagaaactgatttatgatcacttggaagatttgta

Predicted peptide sequence(s):


>SOD1_1|GENSCAN_predicted_peptide_1|200_aa
MATKAVCVLKGDGPVQGIINFEQKARAGTEACLRGRSHPLVPPRTFARSGSPARPRGRPG
PAPGPGPCRPESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGG
PKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEE
STKTGNAGSRLACGVIGIAQ