GENSCAN 1.0	Date run: 16-Jan-104	Time: 03:16:01

Sequence SH3BGR_1 : 66013 bp : 40.38% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1215   1448  234  2  0   86   78   203 0.783  17.29
ccccaaggcatctctgcacaggtctccgattggtgcacagcacagcctggccttttaggg
actgttgtcgcgcgtttaaagtgatagggaaagggtccagtggctgcttttatcgaccaa
tcaaatattttcctgacagatcccaaaatattcctgggccaatggagggaggagcccaag
ATGCCTCTGCTGCTCCTTGGAGAGACAGAGCCTCTTAAGTTGGAGCGGGACTGCCGGAGC
CCAGTGGACCCCTGGGCTGCTGCCAGCCCCGACCTGGCACTTGCTTGCCTGTGTCACTGT
CAGGATTTGTCTAGCGGCGCATTCCCTGACAGGGGTGTGTTGGGGGGAGTCCTCTTTCCA
ACTGTCGAAATGGTTATCAAAGTGTTTGTTGCTACATCTTCTGGGTCCATAGCG
gtaggtgtctggtggactctttcttcctatactcttttctgaataacttagggttggaaa
tatggccaacgttggccttcagtttcttttttgcgtgtagtcagctgtggctctgcaata
agtatgtgcgccctttgctttctgcatttgatttcatagtgttgaaaaagcatggaaagg

 1.02 Intr +   4233   4346  114  2  0   56   16   121 0.246   1.42
attcttggaaaattcattcatttattggagcctcagcattgttataaaatagccatccaa
atacctacctagatggcccgtgtgacagtgcactgggatggtagtgtgctatgtggtgcc
tgacagtgcaggttttcagcctaaggtacaaaatgcttttccatgcatcatcttcttcag
TTCCCACCAAAACACTGTGAGGAAGGCATTGTTACATCCAGTTTGCAGATGAAGAAATTG
GAGATCAGAGCCCTTGCTCAGAAAGCAGCCTTCCAAGCTAGGATGGAAACACAG
gtcgtctctggctcgaatccagtgtgctttatactacagtacagtgatctcagttggaaa
gtctcctaactgtacaagacaataaacgagaggtgccaagtgagtggcaataagaggtgc
tgctgtcagatcactctgacacagtctagtagctaacagtgtctgggtgactttaggaca

 1.03 Intr +   4811   5000  190  1  1   13   71   122 0.347   1.24
atacccccagatcctgtagagccactactcaggacagacagtgcagcctggggggccagc
atgggccatggcaccctggagggtggagaaggggcaaagggggagaggtgaagagtagga
gtgtgtccatgatgggaactgatggggtgctatgcacacccctccctctgggccataaag
AGATGGACTCTTCCAAGAGCTGATACTGTGTCCCTGGGAGTCAGCTCAGCAGGCGCTGTG
AGGAGCTGCACTTTGCAGGCCCACAGGAGCTCCTTGATCAGGGACCCTGCAAGGGGGAGG
ATTTTGGAGGAGAGGGGCCCCATGCTAGAGCCGGGGCACAGGGGTGCAGCAAGACGACAG
TGCCGGCCAG
gttagctcatgtgctcactcccctcttccctcctctggcctggatcctaagacccttttc
tgcaggctcccagcccaggcagaactcaagtgccctgaatagcgtgataagcaatgcact
gggctctgtttaaatgactagtgtttgggggattacagggggcaaacagatttcattttt

 1.04 Intr +  10778  10884  107  0  2   50   48    79 0.272  -0.89
ccacgcctggctaattttgtatttttagtagagatggggtttctccatgttggtcaggct
ggtcttgaactcctgacctcaggtgatctgtccaccttggcctcctaaagtgctgggact
ataggtgtgagccactgtgcttggctgtttgtagatcttaattggcttttgtgattccag
AATCTGGCAGCAGTCAGACCAAAAAATGGTTCACAAAGCTCTGCCCCACCACACGTGCAG
GTTATATTTATCGCCAGAGAAAAGGAAATAACATTCAGAAAAAGGAT
gtgaggtacagacagctaggttgggttataactcagtatttgccttatttgaaagtggtt
tgaacagttggccgcctgtgattggctgaagcttgtctgctgtcaatgactgaaactcag
ctctggttacaaaggcaaatttctagttaggttttcagtttgtttatgtactaagctagg

 1.05 Intr +  11682  11867  186  2  0   69   84   182 0.913  14.86
ttaaatagtcatttggttgaccctttataacaaagaggtgtgattctattattttccttg
tttgaatacttaacaaaattatttgtgttgtatagtataactagaggaaggatttaattt
ttgtaaatgtaagcaaaatatttttcataaacagcctaatatttctctactcttgaccag
ATTAGGAAGAAACAGCAAGAAGTAGTGGGTTTTTTGGAAGCGAATAAAATCGACTTTAAG
GAATTAGATATTGCTGGAGATGAAGACAACAGGAGGTGGATGAGAGAGAATGTTCCTGGA
GAGAAAAAACCTCAAAATGGGATTCCTTTGCCTCCCCAGATCTTCAATGAGGAGCAGTAC
TGTGGG
gtgagtatgtgcttctattaaaaatcctgctgtgtgtgtgtttattagaaattttctaaa
gcagattaagtttgagtcagcatttgaaattattcacaactgtcaggtcatggtctattt
ctgccatccaatagctggatggtagatccattatgaataatcaatatttaagatttagaa

 1.06 Intr +  24442  24522   81  0  0   92  115    25 0.522   4.52
taaagttcatggttagatttcttaactctggaggttagtcatctttgataaagcaaactg
ggatgactttttgtgtgagctcctaacttaaggactaagaaatacaaaagatcagtttcc
gtaaataaactggctcacaagtgtgcagtagttttaaactttctttttctttgcttcaag
GATTTTGACTCTTTCTTCTCTGCAAAAGAAGAGAATATTATTTATTCCTTCCTTGGTTTG
GCTCCTCCTCCAGACTCAAAG
gtaagtttgaacaaactccattggggttcaaaacaggtaatactaaatgaaggtagaaat
caccgcatccaagactgtttaatacatgatgatctctaaattaacattactttagtacac
ttcttattctgatgcagtcctatgcatagagagaatgcagtttttactaaaaaaagttcc

 1.07 Intr +  28469  28734  266  1  2   -3   90   251 0.462  11.59
tctgtttcttctctgtttgctttgctttcctttttatttttatgtaagttgttttcctca
gatgtttggtgatctttgactgtttgtatttaaaacaaagtactgagctggcagtggtgg
gtgcatgtctgtattcccagcaactaggaaggctgaggtgagaggattgcttgtgcctag
GGTTTCGAGGCCAGTCTTGGCAACATAACGAGGCTATGTGGTGGTGGTGGTGGAGGTGGT
AAGGGTGGTGGTGGTGGTGGTGGTGGTGGTGGTGGTGATGGTAGTGCTGGTGGTGATAGT
GATGGTGGTAGTGGTAATGGTCATGGTGGTGATGGTGGTGGTGGAGTGGTAGAGGTGGTG
ATTGTGGTGGTGATGGTGGAGATGATGGTGGTGGTGATGGTGGTGGTGGTGACAGTGATG
GTGGTGATGGTGGTAGTGGTGGTGAG
gtgggtgatggtggtggtgatggtagtggtggtgatgttggtgttggtggtggtgatggt
agtggaggtgggggtgatggaaagtgggagataaatctggctgccagtgttctagaagca
agtagggaagggaatggagggtctcccctttcagaatgtgaacttcttatatagacccct

 1.08 Term +  37857  38076  220  0  1   62   49   196 0.001   8.63
ttccagctgtttgactgaatgggtgatggcaaggcccttacagccagtatggggacatga
cgagggccttgggccagagccccaccaatgccgaggtgctccaggtcctgggggaacctc
aggagtgatgagatgaatgtgaaggtgctggactttgagcacttcctgcccatgctgcag
ACTGTGGCCAGGAACAAGGACTAGGGTGCCTAGTTTTAGGATTATGTCCGAGTCCAAGGA
TTATATGGAAGGTCTTTGGGTGTTTGACAAGGAAGAGAAGGGCACCATCATGGGCGCTGA
AATCCGGCAAGTCCTTGTCATACTGGGTGGGAAGATGACAGAGGCAGAAGTAGAGATGCT
GGCGGCCGGGCATGAGGACAGCAATGGTTGTCAACTCTGA
agagctcgtctgtgtggtgctgagtagctgggcacattcccagcatccccccagccctgt
cctttgccctgtgagacactgtgtatctagccccgaaggctttctggtcacagcaccctt
cccatcttgtctcttttggataatgcttgccatgagcattcaccaataaacttgttctct

 2.01 Init +  47909  47989   81  1  0   52   82    71 0.932   3.92
ctaactcacaatgtgacattttctgcctttattttcctgtctctgaagtgtgggtggtaa
tgactgccctacctacttagtgaagattaaggatgaagagaaatatagtttgaatagtta
agacattgaaatgcaagctattatccttaagaaaattctcaaacactctcactttacata
ATGCGGGTGACAAAATCACCCAAGGAAGCATCGTCCCTTCCCAATGGTGATGTAGTGGGA
GAGGCACTGAGCACCACAGAG
gtaaacactggtgtctcgagccatcgtccccatgcccgtttcctcaaaatgtctacttgg
tcctaatctctctctctctctatccatccacctgtccatctatcatctatctattatcta
ttcatctgtctaatcaatcatctatcatctgtatctatccatctgtattagtctattttc

 2.02 Intr +  49130  49222   93  1  0   54   82   119 0.267   7.14
gcattttggagtttggagatcctatgctctagtcgctaagtgacctaatgagtgggcagt
ctatgtttgcttcatttatatactgtgtgtctaaataagaaagccacagcatatgtggcc
tgtttttttttttcttttttctgtttttgagctcatatcctgggtttcctttatgaccag
GGATCAGAGAAGGCTGAAGAAGGTGGAGAAACTGAGGCACAAAAAGAGGGCAGTGAAGAT
GTGGGCAACCTCCCTGAAGCCCAGGAGAAGAAT
gtgagttttcgctttttcacagcagtttgactggattctctgctgttcgagacttttaca
gggcttgtacaacttgactctgggcacaagcagtcagaaagagggcaaggagctgagagt
ttagccagggaggaagcaagtaatttctactgatgtgttaagcactggaatcctggtgca

 2.03 Term +  60988  61083   96  0  0   -3   47   192 0.044   2.99
tggcatgtgtttgtgtggcatgtgtggtgtgtgtatttgtgtgttgtgtgtgtttgtttg
tgtgttgtgtggtggggtgtgggaggctttgacctctagtccagcattttacagtctttt
tctcactgtatccttggcccttatgcttcttaatactaatgtaagttttgttaaaataag
ACGGAAGAAATAGCCATGGAGGGTGCGGAAGGGGAAGCCGAGGAGGAGGAAGAAACTGCA
GAAGGAGAAGAGCCTGGAGAAGACGAAGATTCCTAG
gccttttcatgcttcatttcttccacttctccaggtagctacaggattctggggtggaaa
agctgctagttaccgtactgtatgctatctgcggcacattttgcttagtaacaggagaaa
gggaattccaattcagggctgtctgtctccttccaaagccctggtctgcacacctttctg

Predicted peptide sequence(s):


>SH3BGR_1|GENSCAN_predicted_peptide_1|465_aa
MPLLLLGETEPLKLERDCRSPVDPWAAASPDLALACLCHCQDLSSGAFPDRGVLGGVLFP
TVEMVIKVFVATSSGSIAFPPKHCEEGIVTSSLQMKKLEIRALAQKAAFQARMETQRWTL
PRADTVSLGVSSAGAVRSCTLQAHRSSLIRDPARGRILEERGPMLEPGHRGAARRQCRPE
SGSSQTKKWFTKLCPTTRAGYIYRQRKGNNIQKKDIRKKQQEVVGFLEANKIDFKELDIA
GDEDNRRWMRENVPGEKKPQNGIPLPPQIFNEEQYCGDFDSFFSAKEENIIYSFLGLAPP
PDSKGFEASLGNITRLCGGGGGGGKGGGGGGGGGGGDGSAGGDSDGGSGNGHGGDGGGGV
VEVVIVVVMVEMMVVVMVVVVTVMVVMVVVVVRLWPGTRTRVPSFRIMSESKDYMEGLWV
FDKEEKGTIMGAEIRQVLVILGGKMTEAEVEMLAAGHEDSNGCQL

>SH3BGR_1|GENSCAN_predicted_peptide_2|89_aa
MRVTKSPKEASSLPNGDVVGEALSTTEGSEKAEEGGETEAQKEGSEDVGNLPEAQEKNTE
EIAMEGAEGEAEEEEETAEGEEPGEDEDS