GENSCAN 1.0	Date run: 16-Jan-104	Time: 03:19:30

Sequence CSTB_1 : 4827 bp : 56.43% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1310   1375   66  1  0   94   94   119 0.837  14.15
cccgcgcgtcccttcttgcggggccaccgcgaccccgcaggggactccgaagccaaagtg
cctcctccccgccccttggttccgcccgcgcgtcacgtgaccccagcgcctacttgggct
gaggagccgccgcgtcccctcgccgagtcccctcgccagattccctccgtcgccgccaag
ATGATGTGCGGGGCGCCCTCCGCCACGCAGCCGGCCACCGCCGAGACCCAGCACATCGCC
GACCAG
gtgggtgggccgcggggacggggccggcccggagtcctgccttagcctcagggcgcggcc
gcggctcctggagcgaaagaagccgctttggccccgctgcgcacccctgggctggcccgg
gctgtggccgtgagaggcctccctccgctcgggcgctgcgcgcgagtgagcagcgggggg

 1.02 Intr +   2820   2921  102  2  0   91   75   112 0.992  11.07
aactgtttttttctactttattattaggctgacagtttaaatgtcccttcagttgtaaga
gacaattgtgtgaagagccagtgtcagaatcgtgtgtgtgctcacatgcgtgcaagttac
tctagcaggagggaatccaagaagccactgagacatcctcattctgtcccttctgtctag
GTGAGGTCCCAGCTTGAAGAGAAAGAAAACAAGAAGTTCCCTGTGTTTAAGGCCGTGTCA
TTCAAGAGCCAGGTGGTCGCGGGGACAAACTACTTCATCAAG
gtagagtgtgggcctcaggagggcctgccccgaacgggtgctggtaggaaaccgcctgtg
caggcccgggctgtgtggtcttaggtgctggggcgccctgtggctgccccctgagataag
catcctactgtgtgtgtccatcggcctttcaggaggactagggcttctggggagctaaga

 1.03 Term +   3249   3377  129  2  0  107   42   122 0.999   7.99
ttcaggaggactagggcttctggggagctaagaaccccaaggaaacaagtgtgggatgtg
aggcatcccctgcacatgcaggagaagacaagattgtcttcagctggctgctaatgacct
ggaggggcgcagcaaggtgacttgggatcagaggcttcgctcactccgctctcttcccag
GTGCACGTCGGCGACGAGGACTTCGTACACCTGCGAGTGTTCCAATCTCTCCCTCATGAA
AACAAGCCCTTGACCTTATCTAACTACCAGACCAACAAAGCCAAGCATGATGAGCTGACC
TATTTCTGA
tcctgactttggacaaggcccttcagccagaagactgacaaagtcatcctccgtctacca
gagcgtgcacttgtgatcctaaaataagcttcatctccgggctgtgccccttggggtgga
aggggcaggattctgcagctgcttttgcatttctcttcctaaatttcattgtgttgattt

Predicted peptide sequence(s):


>CSTB_1|GENSCAN_predicted_peptide_1|98_aa
MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVG
DEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF