GENSCAN 1.0	Date run: 16-Jan-104	Time: 03:31:27

Sequence ABCG1_1 : 80373 bp : 51.95% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1141   1236   96  2  0   22  101   121 0.832   7.28
aaacaagagcacgcgcacctgccggcccgcccgcccccttggtgccggccaatcgcgcgc
tcggggcggggtcgggcgcgctggaaccagagccggagccggatcccagccggagcccaa
gcgcagcccgcaccccgcgcagcggctgagccgggagccagcgcagcctcggccccgcag
CTCAAGCCTCGTCCCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCCCCGGGGCATGGCC
TGTCTGATGGCCGCTTTCTCGGTCGGCACCGCCATG
gtgagtgagcgcatccttcgtccgccgggaacggttttattttcaaggagagcaggaaac
acacaaagactcgcaagctcgacctgacacccctcccaggagcgcgtcctctgggcgctg
acccagggcaccctagagtggcgcccggctccgatcgctgcccctgcccctccgccaggg

 1.02 Intr +   1698   1978  281  1  2   80   93    89 0.904   6.34
ccgatggccttgacctgatggcttctgggcggggggcgtggggagctggggacccggagc
gcactggggactggggaggggccgcagcttgggccggagggaagaggggacttgaagaag
gggagccccgcgcgcgcggctgtgggcttggggaccggggacttctcgcgccatccccag
GAACGCCAGGCAAGGTCTGGGGGAACAAAAGAGGAAGCTGCCCCCAGAGAGCCGGAGCCT
GCGACTGCACTCCCGGGGACACCCTCTCCCGGACCCACTCGGGGAGGCGGCGGCGAAGGC
CCGGGGAGACCCGCGAGGGGCAAGCCCGGATTCCTGCCGGCCGCCTTTCTGCGCGCGCCG
GAGAGAGAGACGCGGTGGGGACAGGGATGCGCATTTCACTTCCCCGAGCTCCGGAGAGGG
ATGGCGGGGTGTCGGCGAGTTCACTGCTGGACACAGTTACT
gtaagtgctgtttccaggggtggtcaggaatctccctttctggttttctggcattaggaa
caaacaacaaaccaatcatcaggcccccagccacccacctcaccttatcctagcgccctt
catgtctacgcccagcacaccaacatcgtagaggtagctaaagtacaaatggaaagtctt

 1.03 Intr +   7603   7846  244  0  1   83   97   221 0.192  20.10
tgacggagatgacaaattcctctaggtgggcacatttctcctggggccaaaggtgctcct
gcagtggaagaagtgttgctattaataaccaatgaccctgagcctcatggtgaatctctt
catgttctttttcttgatgcagcttataacaggtcttgttgcttcctctggtttttctag
AATGCCAGCAGTTACTCTGCAGAGATGACGGAGCCCAAGTCGGTGTGTGTCTCGGTGGAT
GAGGTGGTGTCCAGCAACATGGAGGCCACTGAGACGGACCTGCTGAATGGACATCTGAAA
AAAGTAGATAATAACCTCACGGAAGCCCAGCGCTTCTCCTCCTTGCCTCGGAGGGCAGCT
GTGAACATTGAATTCAGGGACCTTTCCTATTCGGTTCCTGAAGGACCCTGGTGGAGGAAG
AAAG
gtagggagggcggctgctttgtgtatcaagctgggaggagcctctgaaggaggcaacagg
ttgtttgggcaaaatcggggtctggaggttgagaggctgagcttctcttcccaacgccgt
cactgctgtggtcaatttattctattgctttctgcctgaattttcctctcctataaaatg

 1.04 Intr +  11119  11159   41  2  2  117   -1    38 0.060  -3.77
gtccgcctctgcgcctgctggtccaccaagtcggcctcttttgcccctcccatgcatggg
ttcctcctgctcctgcttttgtccctccaattgctggcggtggtctcagtccccagccat
gattaggttaggctgagaagtcagagcccagcctcactctgcatttctctcttctcacag
TGGCGGAGTTTGTATTTGGCATCATCTCTGTGCGACTCCAA
gtgtgacgttgggtcaggggctacttctctgactgctctcagtatattcattttgctgtc
tgtatcaagtccattgttttcaacttttaaaaattcagtttgatgcattgagctaattgt
aatgatcacgcggaggctggatgtcctggcattgctggggaggtgtctccgaaggtaaga

 1.05 Intr +  16645  16747  103  0  1   77   80   141 0.854  12.45
gccctggggttatcaggccacctggcctccacccagacgttccctcccagggcgggattc
atcctggcccgtggtgatgtgcaggctcccggaaggccgggctctgcccactaagtgtca
gctctaacgcaggctctccatactgagtaaaaaagcccgtcctttctctggctggtgcag
GTGCTGACTCTGCAGGCCTGTGGACGCAGGGTGACGTTCGCGCTCTTGCCCGAGCTCAAC
GCCCGGGAGAAAACAGCGCTGCCGGAGCCCCTCGCGCGCGCAG
gtgcgggcggggcgggtgcgcgctgccgcgcgtgtgcagcgcccgcccatccgccgccac
cgcccgcgccggggttactaccggtcaacgctcgctagtaacctccgcggcggagcggcg
gcgcggggagcggcgcgattggctgcgggcgccccgcgctgttgccaagcgcgaggaggc

 1.06 Intr +  18608  18753  146  0  2    1   70   122 0.118   2.21
gggcataatttaggtgttttgtgaaatgttaaacattgtctttcagacgctttgctcaac
cttttgggctcctgaccaaatgcaaagagacccaagggcttgcttttccttgcactcttg
ggttttcattgcctgcttgcttatttgattttgtgactgtggagctggcatttctgtaag
CCCATATAGAAATTACAGTTTCCAAGCCTAAACCCACTAAGCCAACAGGGGCACACAGGA
AACCAGAGATGGTGGTGGATGAAAACCTTTGCAACAAGAAGGAAGGGTACATCTATGATA
ACTATGGTGTTACATTACTAAAAACA
gtaaggatgagtgtcactaacatgagaatgtactctacacaaaagtctggtgaaaaaggg
aggagccctttcactaagtttcatatttatcagcactcacgttaagaattacagcagaag
ctgcaggtttcctgtttctgaagacctgcgaatgagtttgtccagaaaatggccgtgtcc

 1.07 Intr +  22029  22218  190  2  1   41   43   120 0.213   2.48
gttcccctttggtcatttttgggtgtctggtgattgccaggcttccagtatctcaccact
caaattagagccccagaaagggagcatggtgtcatttcatcccctgggccgtggttgtgg
gagcccatggtgccttctgcagggcactggagaacgctgtgtgtgctcatcttgggacag
GCAGGAGAGGAGGGCAGGTGGCAGGATGAGGGCGGCTGTAGCCTGCAGGTCACACAGTGT
TATGCCAGACCACGGTGCCTGCCACGCTGGGTCTCCAACGGCCACACGAGGCACTGCTTC
CATGTTATCAGTGAGGAAACTGTGGCCTGGAGACAGGTGGGCGATGAGTTCAAGTTCCTG
CTGCCAACAG
gtggaccccaggaccaagcctagcccagttgacccctggctcctcctgtttgctctttga
gatcatatgaaacagccagtgactgcctagggccatggcccttttcagtgaacttgaaac
attaaaatgtttactgccttcacacttatggcttaaaaagttgtttggtttgtgttttct

 1.08 Intr +  22812  22901   90  1  0   77   75    55 0.393   3.56
ggcctcccaaaatgctgggattacaggcgtgagccaccgcacccagccagaaagttaatt
ttaatgagaatgaagccgcatcattgaaaagtctgatgagcttgggagttgtctaatggt
ggaggctgccagccaggtctcatgacctggaccagattaagccctactgtccatcttcag
GGAGAGTAAACAGCGTGACCAGCACGGGCCACGCTTGCTCACACCCACCAGATGTGCGTT
CCCGCACCACCCAGGGGACCGAGGGCACAG
gtggggagttaggagggaattcagggcatgggcagaccctctgaaggaatccaggaggct
tgggatctggaatggacactctgggctgacagtcaacagtcctggtgaatagcatgttgg
tctctgggactcttatccttctgactttcacagacacgtagtgagagcactggccacgtt

 1.09 Term +  26244  26404  161  1  2  107   44    68 0.318   2.72
aaaaaaatgttttaaattgctcttttcttgctaaaacatcactgtaagtgataaaattat
ttgcagaggctggaacatgaggttagctgggggtggagagggcatcctaggagtggacat
gggagctcacagggattcaggagggcatccagaccctgaacttccttcgtcccctcccag
TGCAAGGTTCTGACAAGAGCCTGCCTGAGCCCTTCTCTCAGTATTTAGTAACACTCGATC
CTAACAGAAGAAGGTCGGCCATTTCCACCGTCCTCTGTGCCAGCTCTCAGGACCAGATTA
GAAACACAGTTAACACAGCCATTGCCTTGCCAATAAATTGA
taaagctaaaagacttcaaaagcttctcttctgcactgcatttcctaaagtctaatttac
agtcttgtcttactttgcaattcccactcttttttttggtgaagaaattgagcttttcct
catctaaaatcacggcagattttgagttgcaaggatcacaattagtgaattttaaaaatt

 2.01 Init +  38281  38548  268  0  1   82   76   146 0.782   7.94
tttagggctgctgcgatcatttaggcagattaaacctcataagtggtttcccatacaaga
aagatgctagcagtgcaacagacagaacacttacctgcctgccctcccgccaggaggtgg
tcttccaacttttgcccggagtctacagagggtgggccctctctgctggggctccgggac
ATGGTCAGGAGAGGTTGGTCTGTCTGTACCGCCATTCTCTTGGCCAGACTGTGGTGTCTG
GTCCCTACTCACACCTTCCTGTCAGAGTATCCAGAGGCCGCAGAGTATCCACACCCTGGC
TGGGTGTACTGGCTACAGATGGCTGTGGCTCCAGGTCACCTGCGTGCCTGGGTGATGAGA
AATAATGTCACAACAAATATCCCATCTGCATTCTCTGGGACACTGACCCATGAAGAGAAA
GCAGTTCTCACAGTTTTTACAGGCACAG
gtcagctctcagagtgctggggacagggttcccaccaggcagccctttctgctcctccca
gagactgatggcttctctgcattcagagggatctgggagcattgcaggaataggctctgg
ctcttcagaaatgatcacgagcttaaggaactgggtctgcaatgtgaagccttaggtcca

 2.02 Intr +  41247  41437  191  1  2  -16   52   157 0.392   1.53
caccttgcaaaggcccctgcctgggagacatgtcttggtgtgagagagacgacattgcgt
tcccagatgtcgctggtgctgggctcagctccaaagttctggagcagagtcagcaaagca
cagcctggagaccagatctgtgctctgcctgagtttgtaagtgaagttttgttgcagtag
CCACAGCCGTGCATGTACAGGTGGCAGCTTTAGCTTCTGCTAAACTGGAGAGCTCAGTGT
TTGTGACAGACTGCGTGTCCTGCAAAATCGAAAATGTCTGTGATTCAGCTCTTCAGGGAA
AAAGGGTGCCGATGTCTGGCCTACAGGGCTCAAGCATTGTCATCATGCCCCCATCCAACC
GTCCACTCAAG
gtgcattgactgaggctggctggctggagtcatcatgtgggccctcaggctatggaggca
aatcgagtggcattgcctctgcggagctggccattaccttgtttcctaactgtcactcat
ttgataaaaactgacaaggttgctagagccacgtgtttgcaaaccagtgggcattcgcac

 2.03 Intr +  41921  42071  151  1  1  117  100    25 0.778   6.85
gcccattccctcctccctttggatggaagaaaggaaaagagcaggggagagagaggccaa
tggcaaaggagcacagcgggagaaagaaggcccccaggcttgagcggccctgaagctcag
cagctgtgggttggacggtggtgttggcttgctcttccccttccctcctggtttcttcag
GCCAGTGCGGCATCCTGCACGTGGTCAGTCCAAGTCCAGGGAGGGCCCCATCACCTGGGG
GTGGTCGCTATCAGTGGCAAAGTCTTGTCAGCAGCTCATGGGGCAGGAAGGGCCTATGGT
TGGGGGTTTCCTGGCGATCCCATGGAGGAAG
gtgaggatgagttgtgttgcttctcgggtgaagctggtcacgtggccctaaaggcattca
gagtagatgctcacttcaaccctgcaggtggcattgggcggcaagcatttctaggaccca
gcttccaccacggagccgaatggtggcccggctggggccagggctcctctcgagggggcc

 2.04 Intr +  53002  53119  118  2  1  101   99   103 0.925  12.73
aagacgtagaccagggaattcgaaagacatgaagttcatgttcttccctggaatgcagcc
ttttctatgatgcatgtcaaaggttgcctttggccttggtcatgtgtacttgaacatttg
catatttactgcattagagataaaatgaaatgaatatgaatatgatctgcttttttgcag
GATACAAGACCCTCCTGAAAGGAATTTCCGGGAAGTTCAATAGTGGTGAGTTGGTGGCCA
TTATGGGTCCTTCCGGGGCCGGGAAGTCCACGCTGATGAACATCCTGGCTGGATACAG
gtgagcagccctgcccagggcgcaaagttctctcccgggtgtcaggccagcagtgggaac
agtggagctccttccatcagccccatcacctggagcaggctgtggtctacagcagtagtc
caggggagagagtgacattgagaggctgcacttgccaagggccatatgatgggtggagag

 2.05 Intr +  55235  55367  133  2  1  110   89   297 0.980  33.15
gatcgctgcagtgctagcgaggtccggtccctttctgcccctcggggtccccgtggccag
tggttcagctgggaagatgctgggaggcaagcccccgtctctggctcccctctcctgccc
cgggaggtggaggaggagcaggagcccggctgacggcttctcctgtccttggttctgcag
GGAGACGGGCATGAAGGGGGCCGTCCTCATCAACGGCCTGCCCCGGGACCTGCGCTGCTT
CCGGAAGGTGTCCTGCTACATCATGCAGGATGACATGCTGCTGCCGCATCTCACTGTGCA
GGAGGCCATGATG
gtgagctccgccctgccccgccccactccgcccctgccgcctgtccccagcgcccacatt
agacacagcactggccgagtgcccagctgcgagggacccaagggctctgccacgcggcct
gcacagggccagcaacctccctctagcggagttctaacaccagactcgctgttgggacag

 2.06 Intr +  58827  58877   51  2  0  129  115    18 0.002   8.19
gctgcaccgtggctagcggcattgtggctagctgcactgtgggtagctgcaccgtggcta
gtggcactgtggctagctgcatcttggctagctgcaccgtggcctgcagtgcgggcatga
ggctcacactgccagtggccgtctgttctgcttccacactgttgtccttgtcccctgcag
GTGTCGGCACATCTGAAGCTTCAGGAGAAGGATGAAGGCAGAAGGGAAATG
gtaagtgggttgtttggtgcccacaagtggtccagaaagtgcatgacgtgcatgtggaag
gtgtgcctgccggggcattttggcattggcttttgtttgttgatttgtttttgccttgcc
ttccgtgtgtgggacaggcaacatttcagggagtgctgtggcctgcagcagccagaggcc

 2.07 Intr +  62855  62971  117  1  0   44   57    78 0.047   1.47
cgcatgtgtggggcccccacagtgagcctggaagcaccagagccactcagtcggccaaga
gcgtcgcccagtggttccagaagatctggaggcctcgtcctgggaagaccagcagtcgat
gccagctgggaagagggctctgcccaccttgcacgccccccacccaccagccttttccag
ACAGCCTTCCAGAAGCTGTTTCTGGGTTGGCGGCCCTCAGAGCCAGGCATCCAGCAGAGG
CACCAGGGCTGGGGTGAGGGCATCAGCAAGGAGGTTCAGGACAGGGCTGGAGCCCAG
gtcggctgaccctgtactgccacctgccctggcctgtccagcagccgtgccccggttctt
tctgtcaccaaagctgcactttgtaccgactgtgcataaataattcagaagctcagagtg
gaaattttcttcctcgtgagttcttcctcccttcagatgacttcatctccctagaggagc

 2.08 Intr +  64206  64351  146  2  2  123  111   247 0.999  30.09
gcacctgccccacttggcactgggcagcctggagtgggttcgacttgcgtggcctccacg
tgggccaggcacggtgtgtccagcaggctgagggcggctggcaggtcttcctgcatgggc
catgggaggtggtgagctttggcgggcagctcccaatgtctctcgttctgttgcccccag
GTCAAGGAGATACTGACAGCGCTGGGCTTGCTGTCTTGCGCCAACACGCGGACCGGGAGC
CTGTCAGGTGGTCAGCGCAAGCGCCTGGCCATCGCGCTGGAGCTGGTGAACAACCCTCCA
GTCATGTTCTTCGATGAGCCCACCAG
gtaagtcaggagcatctgagctggtgtccaggggcaggaagaaccccctgtattcagcgg
ttcttccaggtgaccctgacatcctgatgtagcctcagagggggtgagttgagctcaccc
ggcggttcctccttccatctgggaccactgggcagaagagctgacttatgccccctctct

 2.09 Intr +  66492  66615  124  0  1   58  101   158 0.969  15.19
ccctgccactgagcagcaaaacaaacagcaagagcagagcccggcctgggacggggcagc
tgcagctgcagcccctgatgccaagccctctgggacaggaactccctggacccccggaac
ctggggcagtggctagttcctgccgcccgcaggcgtctcacggtgcctcttgacttgcag
CGGCCTGGACAGCGCCTCCTGCTTCCAGGTGGTCTCGCTGATGAAAGGGCTCGCTCAAGG
GGGTCGCTCCATCATTTGCACCATCCACCAGCCCAGCGCCAAACTCTTCGAGCTGTTCGA
CCAG
gtacgcgggccccgggccctccccgccagattaccactgcactcaggtcagcctgaatga
caccaaaccctgggtacccactgccttctgttagctcgtggggcgtcttcatgacaccaa
accctgggtacccacagccttctgttagctcatggggcatcttcatgacaccaaaccctg

 2.10 Intr +  67812  67926  115  2  1  114   99    25 0.998   6.72
ttcccttcagatgttaatagggcccttgggggtgatgtaaagctctcaggagaggaagtg
gctgatcgctgggctgactgattgatcggttgattgattggttgattgattgattgaggg
ctccggttgccttccgaggaaggcagggcttgatccctttttctccttccttttttccag
CTTTACGTCCTGAGTCAAGGACAATGTGTGTACCGGGGAAAAGTCTGCAATCTTGTGCCA
TATTTGAGGGATTTGGGTCTGAACTGCCCAACCTACCACAACCCAGCAGATTTTG
gtaagcggagtcctgagcagctcgggggacagaaaggggattttcctcctctgtgggtct
cacttttagctgacgcccccaactcagaaaccacttgactaccacaaatagctcaagtgt
catccagttataaaacgtttaaagaacaaaaaaattaggtttcatttcctctagactcta

 2.11 Intr +  69821  70005  185  0  2  113   90   125 0.517  15.23
ggggggtttgagagccgcacgctggttgataaatgattttgacgtcatgccattagcacc
gccacgcagcatctatgtaatcgctttaaaacattcccacttgaataacgactttcgcat
ttgggtggttggggtgtccttcctggagcccgggctgacccccgtctgtgtctcctgcag
TCATGGAGGTTGCATCCGGCGAGTACGGTGATCAGAACAGTCGGCTGGTGAGAGCGGTTC
GGGAGGGCATGTGTGACTCAGACCACAAGAGAGACCTCGGGGGTGATGCCGAGGTGAACC
CTTTTCTTTGGCACCGGCCCTCTGAAGAGGTAAAGCAGACAAAACGATTAAAGGGGTTGA
GAAAG
gtaatgcaaatcccgaagccccctgggggaggctgcacgtggcaccgtgcactgctgcat
gagagctctttccgagcaagaaggagccgtggctccggactggctttcacccgctcccct
cttgcgtgtgtcctcaggactcctcgtccatggaaggctgccacagcttctctgccagct

 2.12 Intr +  70143  70244  102  2  0  107   99   118 0.998  15.67
tgaagaggtaaagcagacaaaacgattaaaggggttgagaaaggtaatgcaaatcccgaa
gccccctgggggaggctgcacgtggcaccgtgcactgctgcatgagagctctttccgagc
aagaaggagccgtggctccggactggctttcacccgctcccctcttgcgtgtgtcctcag
GACTCCTCGTCCATGGAAGGCTGCCACAGCTTCTCTGCCAGCTGCCTCACGCAGTTCTGC
ATCCTCTTCAAGAGGACCTTCCTCAGCATCATGAGGGACTCG
gtaaggctgcccgcatcttctcctgtagctggggaacccgtgggtcattttctcagactc
gtcctgacggaatgtgttcgttcattctcacattgctataaagaaattcatgaggccagg
catggtgactcatgtctgtaaccccagcactttgggaggccaaggcaggcagatcatttg

 2.13 Intr +  71982  72150  169  2  1   56   84   248 0.978  21.23
gtgtgtatgtgagtcgctttagggtttggcttgtttctctggaggagaagacaggataaa
gtctaagacgtgctgtcacagagttcagggtcccatgcttccaaaggccgcatccgggtt
gttctctgagccgaggacggctttgcgaacgcactgggtaagatgcgggtctgtccccag
GTCCTGACACACCTGCGCATCACCTCGCACATTGGGATCGGCCTCCTCATTGGCCTGCTG
TACTTGGGGATCGGGAACGAAGCCAAGAAGGTCTTGAGCAACTCCGGCTTCCTCTTCTTC
TCCATGCTGTTCCTCATGTTCGCGGCCCTCATGCCTACTGTTCTGACAT
gtgagtgacagaccgctgaccccttcttccttattttcaattcctacccaagcatggggg
cctgaagtcacgccttgaccaacagatgagttttctaaacacaatgtttttgttttttta
aaatatcatcttctttgttgacagatgcaagttgtattgtatttgctgttagataagaaa

 2.14 Intr +  73024  73124  101  2  2  103   89   166 0.999  18.53
ttatgcaaacgggtggcgtttttcaggctagcaaaacacatcctctgtttgttcaatctc
tcagtgccctaggccagagctgggttaccagccgctcagctcaagatcgcctgttgggat
gttaaacgggctcgctgcacatggtcactgacccttcttttttgcttttctatctcctag
TTCCCCTGGAGATGGGAGTCTTTCTTCGGGAACACCTGAACTACTGGTACAGCCTGAAGG
CCTACTACCTGGCCAAGACCATGGCAGACGTGCCCTTTCAG
gtgtgttagccaggggctggaatttgaaacgggggcaagagttctcctgtacacccttta
tatcgagtaagaggacctgccagggatgcagggtgacatggcccgacttcgggagctctg
gtgggagctgcggggaagggcctgacttcgggagctgtggcgggagctgtggggagtggg

 2.15 Intr +  73430  73588  159  1  0   76   50   287 0.375  24.40
agctgcggggaagggcctgacttcgggagctgtggcgggagctgtggggagtggggaagg
acccgactttgggagctctggcgggagctgcggggaagggctggctgcccaggagctttg
ctgttggcctgctgtggtgggaagcggctgagcccgcggctgacgggtccttgtttccag
ATCATGTTCCCAGTGGCCTACTGCAGCATCGTGTACTGGATGACGTCGCAGCCGTCCGAC
GCCGTGCGCTTTGTGCTGTTTGCCGCGCTGGGCACCATGACCTCCCTGGTGGCACAGTCC
CTGGGCCTGCTGATCGGAGCCGCCTCCACGTCCCTGCAG
gtgccagcccaggaggcgctaagtgagggcatgacggctgggcttccctgagctaccttg
gcctgagctagggggctctgccaccccttcccctacttctgccctgaccctcctagatgg
ggtcgttcccacgggaagggcccgcattgtcgagggtcaggatcagctggcttccacagt

 2.16 Intr +  76474  76592  119  0  2   68   74   244 0.859  20.77
tcagagatggtgaccccacacctcgggaacgctgcaccttctgccacattaagcatcatc
attaccctgcccagaaggtgccctggccctgcccgggggaagctggcgtgggcgagcctc
ctctgcaggaggccaggctgcaggttctgctacatctgtcctgtgtgcccccaactccag
GTGGCCACTTTCGTGGGCCCAGTGACAGCCATCCCGGTGCTCCTGTTCTCGGGGTTCTTC
GTCAGCTTCGACACCATCCCCACGTACCTACAGTGGATGTCCTACATCTCCTATGTCAG
gtagcgggcgtggggcacgcatggcgtggggaccgagggtgacgggggaagaaccgtctc
caacagcgtgaggggctcacaaaagccactctgggctgctggccaagagcagattacaca
tctgaggatccaggccttccatcttcctgctagttccacctcctcctaccctcaccaaca

 2.17 Intr +  78096  78320  225  0  0  107   83   399 0.702  38.93
tgcacgtgtttgtcttaagaaggtggtgggcggtgaggaagtattctggggaaggcggcc
ctttgggaagggaggatagccaagctgggaatcgcagggagggtgaacgacattgacctt
cagccaacggcgtggctggctgggagaacgtcctccctcatgcctggcctttcctcctag
GTATGGGTTCGAAGGGGTCATCCTCTCCATCTATGGCTTAGACCGGGAAGATCTGCACTG
TGACATCGACGAGACGTGCCACTTCCAGAAGTCGGAGGCCATCCTGCGGGAGCTGGACGT
GGAAAATGCCAAGCTGTACCTGGACTTCATCGTACTCGGGATTTTCTTCATCTCCCTCCG
CCTCATTGCCTATTTTGTCCTCAGGTACAAAATCCGGGCAGAGAG
gtaaaacacctgaatgccaggaaacaggaagattagacactgtggccgagggcacgtcta
gaatcgaggaggcaagcctgtgcccgaccgacgacacagagactcttctgatccaacccc
tagaaccgcgttgggtttgtgggtgtctcgtgctcagccactctgcccagctgggttgga

Predicted peptide sequence(s):


>ABCG1_1|GENSCAN_predicted_peptide_1|450_aa
XQASSPPPPPPPPPPPPGHGLSDGRFLGRHRHGTPGKVWGNKRGSCPQRAGACDCTPGDT
LSRTHSGRRRRRPGETREGQARIPAGRLSARAGERDAVGTGMRISLPRAPERDGGVSASS
LLDTVTNASSYSAEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSS
LPRRAAVNIEFRDLSYSVPEGPWWRKKVAEFVFGIISVRLQVLTLQACGRRVTFALLPEL
NAREKTALPEPLARAAHIEITVSKPKPTKPTGAHRKPEMVVDENLCNKKEGYIYDNYGVT
LLKTAGEEGRWQDEGGCSLQVTQCYARPRCLPRWVSNGHTRHCFHVISEETVAWRQVGDE
FKFLLPTGRVNSVTSTGHACSHPPDVRSRTTQGTEGTVQGSDKSLPEPFSQYLVTLDPNR
RRSAISTVLCASSQDQIRNTVNTAIALPIN

>ABCG1_1|GENSCAN_predicted_peptide_2|825_aa
MVRRGWSVCTAILLARLWCLVPTHTFLSEYPEAAEYPHPGWVYWLQMAVAPGHLRAWVMR
NNVTTNIPSAFSGTLTHEEKAVLTVFTGTATAVHVQVAALASAKLESSVFVTDCVSCKIE
NVCDSALQGKRVPMSGLQGSSIVIMPPSNRPLKASAASCTWSVQVQGGPHHLGVVAISGK
VLSAAHGAGRAYGWGFPGDPMEEGYKTLLKGISGKFNSGELVAIMGPSGAGKSTLMNILA
GYRETGMKGAVLINGLPRDLRCFRKVSCYIMQDDMLLPHLTVQEAMMVSAHLKLQEKDEG
RREMTAFQKLFLGWRPSEPGIQQRHQGWGEGISKEVQDRAGAQVKEILTALGLLSCANTR
TGSLSGGQRKRLAIALELVNNPPVMFFDEPTSGLDSASCFQVVSLMKGLAQGGRSIICTI
HQPSAKLFELFDQLYVLSQGQCVYRGKVCNLVPYLRDLGLNCPTYHNPADFVMEVASGEY
GDQNSRLVRAVREGMCDSDHKRDLGGDAEVNPFLWHRPSEEVKQTKRLKGLRKDSSSMEG
CHSFSASCLTQFCILFKRTFLSIMRDSVLTHLRITSHIGIGLLIGLLYLGIGNEAKKVLS
NSGFLFFSMLFLMFAALMPTVLTFPLEMGVFLREHLNYWYSLKAYYLAKTMADVPFQIMF
PVAYCSIVYWMTSQPSDAVRFVLFAALGTMTSLVAQSLGLLIGAASTSLQVATFVGPVTA
IPVLLFSGFFVSFDTIPTYLQWMSYISYVRYGFEGVILSIYGLDREDLHCDIDETCHFQK
SEAILRELDVENAKLYLDFIVLGIFFISLRLIAYFVLRYKIRAEX