GENSCAN 1.0	Date run: 16-Jan-104	Time: 01:39:56

Sequence ZFP64_1 : 43107 bp : 45.08% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1551   1596   46  2  1   98  106   112 0.905  14.85
ccagcgccctctaggcagcggaagtgcagcttgctttacatccgtcctccccgcctcgca
gagttgggagaaggcagggtggggggtgtggaaaaataaaaggaaaagtccttgcaccat
gtagatcagcgtcccccactttggcatcccggccggccggggacctcccagtctgcggcc
ATGAACGCGAGCAGCGAGGGCGAGAGCTTCGCGGGCTCGGTGCAAA
gtaagtgcttttccgggagcagtgcgcgctccggggcccagtgcgcgctccggggcccgg
gcccaagcacgtctgcgacgcagccagcaggcccggggccccgaaatcggggtgacggct
cggagccgcgtctcggggaccgcggcgggcgcgctgtgcagggggcgccggagtgggctt

 1.02 Intr +   6122   6355  234  0  0   27   92   337 0.885  25.66
gctgctagggcacaattaggatgcagttcgcaggaagaggaaggtggagtggatactggg
ccactacccagccatgtctgccaccatgccttttcttcctaccatgaatctggtctgcat
tacaattcaaagctgtttggaattaatccgttactttccctttgtcccatggagttccag
GTGGCACAACGGTGCTGGTGGAGCTGACTCCCGACATCCATATCTGCGGCATCTGCAAGC
AGCAGTTTAACAACCTGGATGCCTTTGTAGCTCACAAGCAAAGTGGCTGCCAGCTGACAG
GCACATCCGCAGCAGCCCCCAGCACGGTCCAGTTTGTATCGGAGGAAACAGTGCCTGCCA
CCCAGACTCAGACCACCACCAGAACCATCACCTCGGAGACCCAGACAATCACAG
gtacagctggagcatgggggagtcggccagaattggcctggctgtgtctcaaacacgtcc
atggaacttgttaaaaatatagattcccagagcccaccccctagggttgctgattcatta
tttttaacaagctccaccaggaagccagctgcccagccaggtttgggagctgctaggtta

 1.03 Intr +  27168  27323  156  1  0   44  103    76 0.788   4.68
ggatgctctctagtgtctcattagctagaactgggtcacatgatcactgtgaagccgcaa
gggaggctgggaaagcaaactagtacatgcattctctctacaaaggaaagtaggcagaca
ccatagctagcgggcatttatattaagaaaattaataatcaccatatcttttagtttcag
CTCCAGAATTTGTTTTTGAACATGGCTATCAAACTTACCTGCCCACGGAAAGTAATGAAA
ACCAGACAGCCACTGTCATCTCTCTCCCTGCCAAGTCACGCACCAAAAAGCCCACAACAC
CACCTGCTCAGAAAAGGCTTAACTGTTGCTATCCAG
gtaaaggcagcattatgtcctacttgtgtagagggtgtgatatttaaccaggctccaggg
ctcctcctcatgagttcctgacaactgctcatggatgtgttccaaactacctggcataaa
aatcagagccccctggcatttacatcagcacatacaacctatctcccactgtctgtggtc

 1.04 Intr +  28430  28492   63  0  0  131  114    68 0.999  12.39
gaaccacaaaatgacggtgtgtttttcccggtcatcacatatgaaggcacatgagatctc
tttttcccattaccgtggtgttaactcttgtcacttggttaaggatgtttctaccagttt
tctccatgctaaaagttactaagttttcctttgtaattaatctttcctttttttttttag
GTTGCCAATTCAAGACTGCTTATGGCATGAAGGACATGGAGCGGCATTTAAAAATTCACA
CGG
gtaagtagcatttctttagcgcatatgccctcaacacctgctctgtgctaggagatgggg
atccacataggtcagacgaatgataccactccaaacgtcactggctgttatgggaataca
agtccagattttaaaaaataaggtgccatttgtacacatgactttggcagaaaaatcttt

 1.05 Intr +  32813  33064  252  0  0   52  100   419 0.999  36.91
gaagaaacttcccctctcccaagatgttagctctttgccaatcatccacccagtgtttta
gggtttttggaatattcttcggtggttgtatatgacttttttcgtaaggcagtgggaaat
aagccttttccttttttaatcttgtttcctgctgccatctgtgtgtgtatgtgtttgaag
GAGACAAACCCCATAAGTGTGAAGTCTGTGGCAAGTGCTTTAGCCGGAAAGACAAGCTGA
AAACTCACATGCGGTGCCACACGGGCGTGAAGCCCTACAAGTGTAAGACGTGTGACTACG
CCGCTGCCGACAGCAGCAGCCTCAACAAGCACCTGAGGATCCACTCGGACGAGCGGCCCT
TCAAATGCCAGATCTGCCCCTACGCCAGCCGCAACTCCAGCCAGCTCACTGTCCACCTGC
GATCCCACACGG
gtgagtcctgcctgttatttgctctctacgctcctcactttctatggcataaatcataag
caccttaaagcattcagccacaatgtaagaaatcgagttggaacctttgctcatcccgtt
gtttgcagttttgtttttttttgttgttgttgttttgtctcgctctgttgccctggctgg

 1.06 Term +  39759  41041 1283  1  2   80   39  1469 0.996 132.96
tccggggaaagataaagacgccctgcccctcttcccccactgccaggggctgctagaagc
tgcagttaggaggtctgcacccacccaccttgtataagcgattttctggtgtgtgcttcg
gggggatccgctgtggttgttgcctgcctgttcttatcgaaactcaccttgtgttgacag
GGGACGCCCCCTTCCAGTGCTGGCTCTGTAGCGCCAAGTTCAAAATCAGCTCGGACTTGA
AAAGGCACATGCGGGTGCACTCGGGGGAGAAGCCTTTCAAGTGCGAGTTCTGCAATGTCC
GCTGCACCATGAAGGGGAACCTCAAGTCGCACATCCGTATCAAGCACAGCGGGAATAACT
TCAAGTGTCCTCATTGCGACTTCCTGGGTGACAGCAAAGCCACCCTCCGGAAGCACAGCC
GCGTGCACCAGTCGGAGCATCCTGAGAAGTGCTCGGAATGCAGCTACTCCTGCTCCAGCA
AGGCCGCCCTGCGCATCCACGAGCGTATCCACTGCACCGACCGCCCTTTCAAGTGCAACT
ACTGCAGCTTCGACACCAAACAGCCCAGCAACCTGAGCAAGCACATGAAGAAGTTCCATG
GGGACATGGTTAAGACTGAGGCTCTAGAGAGGAAGGACACCGGCAGGCAGAGCAGCCGGC
AGGTGGCCAAGCTGGATGCCAAGAAGAGTTTCCACTGCGATATATGCGATGCCTCCTTCA
TGCGGGAGGACTCGCTCCGCAGCCACAAGAGACAGCACAGTGAGTACAGTGAGAGTAAGA
ACTCGGACGTGACCGTTCTCCAGTTTCAGATCGACCCCAGCAAGCAGCCCGCCACGCCCC
TCACTGTGGGACACCTCCAGGTGCCCCTCCAGCCCAGCCAAGTGCCCCAGTTCAGCGAGG
GAAGAGTCAAAATCATCGTTGGGCATCAGGTGCCCCAGGCGAACACCATCGTCCAGGCTG
CCGCCGCTGCAGTGAACATCGTCCCGCCTGCCTTGGTGGCCCAGAACCCAGAGGAACTCC
CAGGGAACAGCCGGCTGCAGATCCTGCGCCAGGTCAGTCTGATCGCCCCCCCTCAGTCCT
CGCGGTGTCCGAGCGAGGCGGGCGCAATGACCCAGCCGGCTGTCCTGCTGACCACCCACG
AGCAGACGGACGGAGCCACTCTGCACCAGACTCTCATCCCCACGGCCTCAGGTGGCCCCC
AGGAAGGCTCTGGCAATCAAACTTTCATTACCAGTTCGGGTATTACTTGCACTGACTTTG
AAGGCCTAAACGCCTTGATTCAGGAGGGGACAGCAGAAGTGACAGTGGTGAGCGATGGAG
GCCAGAACATCGCAGTGGCCACCACAGCGCCACCGGTCTTCTCCTCCTCTTCCCAGCAAG
AACTACCCAAGCAGACCTACTCCATCATTCAAGGGGCAGCCCATCCAGCTTTGCTCTGTC
CCGCCGACTCCATTCCAGATTAG
tgcttaaaaaaacaaaaggagtgggggaaaggaattgagaaaaagaaatcttaagtagaa
ttctctaaaaggtttgctcttaatgttttctttgttttgttttgtttttgagacggagtc
tcgctctgtttcccaggctggagtgcagtggcgctatcttggctcactgcaacgtccgcc

Predicted peptide sequence(s):


>ZFP64_1|GENSCAN_predicted_peptide_1|677_aa
MNASSEGESFAGSVQSGTTVLVELTPDIHICGICKQQFNNLDAFVAHKQSGCQLTGTSAA
APSTVQFVSEETVPATQTQTTTRTITSETQTITAPEFVFEHGYQTYLPTESNENQTATVI
SLPAKSRTKKPTTPPAQKRLNCCYPGCQFKTAYGMKDMERHLKIHTGDKPHKCEVCGKCF
SRKDKLKTHMRCHTGVKPYKCKTCDYAAADSSSLNKHLRIHSDERPFKCQICPYASRNSS
QLTVHLRSHTGDAPFQCWLCSAKFKISSDLKRHMRVHSGEKPFKCEFCNVRCTMKGNLKS
HIRIKHSGNNFKCPHCDFLGDSKATLRKHSRVHQSEHPEKCSECSYSCSSKAALRIHERI
HCTDRPFKCNYCSFDTKQPSNLSKHMKKFHGDMVKTEALERKDTGRQSSRQVAKLDAKKS
FHCDICDASFMREDSLRSHKRQHSEYSESKNSDVTVLQFQIDPSKQPATPLTVGHLQVPL
QPSQVPQFSEGRVKIIVGHQVPQANTIVQAAAAAVNIVPPALVAQNPEELPGNSRLQILR
QVSLIAPPQSSRCPSEAGAMTQPAVLLTTHEQTDGATLHQTLIPTASGGPQEGSGNQTFI
TSSGITCTDFEGLNALIQEGTAEVTVVSDGGQNIAVATTAPPVFSSSSQQELPKQTYSII
QGAAHPALLCPADSIPD