GENSCAN 1.0	Date run: 16-Jan-104	Time: 00:59:26

Sequence TPD52L2_1 : 28643 bp : 54.46% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    887   1052  166  1  1   68   64    61 0.312   1.75
tataaatacaataaataacaggacttacgggggcaggctgacccctaaagtaaggggtcg
ggctggaaaggatctcaaggggtcagagtttgagccgccgaggcgcgcgagccccagcac
tcctaggcagctgcatccgccccggaagatcccctggggccctgcgctggctttccacag
CGCCATGTTGGACGGTCCTCCCACTTCCCACCTTCCCAGTCCTCCCGCTACTCTGACCGT
TCTACCTGTGATTCTCGCTGGTGGAGTCAACCTGGAATGGATTCCCGCCGAACCACGCCT
CCCTTTCCTGGTTCGCCCGCAGTTTCGGCCTATCAGGTTGAGTCGG
gtaaaccaggacgggccaagcggcactctcattggatatcactggtgggggcgggaagaa
ggcggagcacgtgcccgggcggaagtagccgtcgcatcgcggattacgaaacgccgcgga
gctgaggcagttccgctggctagtgtgtacgcggcgagcttctcccggcgccgcccgctc

 1.02 Intr +   1426   1545  120  2  0   85   48    67 0.783   3.37
cccgcgacagcggtccggacgccgcccgaacatggactccgccggccaaggtacctgccg
ggcccggccccttcgccgcagatgggcccaggctgcccgttgttctccgtctcccggggt
cgcgtctgcgactctctgtcctctcggtctcggttcacccaccccgcggcccctcttcag
CTCCCGGGGCCACTGACCTCGAAGCTTATGATGGTCGTGGTGTGTTTTTTGCCCGCGGCC
CAGACCGCTTCCTGGGCTCTCTCCAGCCGCCCTCCTGGTCTCCCCTGGGACCGTTCCGAG

gtgtggttccctggcgcccgccgttgctcccgtagtttgggttctgtcgctcccagcagg
tctcgcttatgccgcccaccccgtgccctgctcttgcttgctctgccaccccccggtccc
tgcgcggggccctcgggttcacgctgtctggccctggacccagtccgaggtgttgagggc

 1.03 Intr +   5207   5352  146  0  2   86   48   152 0.861  11.51
tgaggtgtggctgccctcgtctactgcccatgctgtcctcacagacctttcagagaagag
gtgttagtctccagggtctcacccactcccacctgtgcttttgtcctgctagagacctct
accgtatttacttggaactaacttatttgacactttgtggcctcattttgtctctggcag
ATATCAACCTGAATTCTCCTAACAAAGGTCTGCTGTCTGACTCCATGACGGATGTTCCTG
TCGACACAGGTGTGGCTGCCCGGACTCCTGCTGTTGAGGGTCTGACAGAGGCTGAGGAGG
AGGAGCTCAGGGCTGAGCTTACCAAG
gtgctgtggcttggctgtctgtcctggggtgaattggagttaaggccctcttggattagt
gagaggccagggtactggccacgctcgggaggaattgccctgggtggtcacctaccctgc
tctgtgttccgactgataacggggttctctttgtatgtgcccagctccatgcactggact

 1.04 Intr +   9579   9716  138  2  0   99   20   137 0.021   9.17
aaaaaaaaaaaaaaaccaaaacccaaaaatcagatgtctgctgtagatgctgttattcct
aggacgagttaatgctttggtaagcggaaagttcttgtgtaactcatggcactgtgcatg
aggatgttagtcacttcctgcagtagtgatggctcatcatgtcaactgcatgctttgcag
GTGGAAGAGGAAATTGTCACTCTGCGCCAGGTCCTGGCAGCCAAGGAGAGGCACTGTGGA
GAGCTCAAGAGGAGGCTGGGCCTCTCCACCCTGGGGGAGCTGAAACAGAACCTGTCCAGG
AGCTGGCATGACGTGCAG
gtctctagcgcgtaggtacctgccccaggcgcacccctgggggctgaagagaacgggcac
cacacgtgccccggcatgtgggggggcgtcgtcatgcccagggacgagttgcagccgtgg
agttgagtggcctgtttggaaggatccagagagaggctctgagcccttggcccagcgact

 1.05 Intr +  14093  14248  156  1  0   78   12   112 0.033   3.32
gacggaagggatgcggcttgggaggtggggcctgaggatgtggccatggcgcgtgctctt
cctggctggtgcctctcctagtcagcttcaggagatgggctgtagatgtacctccactgc
ccagagctctgcaggggaaggcagtaaaagctccctgcatcctgacccacgtgtttgtag
ATCCTTTCAGCTATTGGCGCCCTGGAGGATGGACGGGAAGGAGAACGTGGCCGGTGGGTG
GAGGATAGCACTGGTGCCTGGCCCCATGAGGCTGCAATGCGGCCACATTCTCAGTGGGTC
ATGTCTGAATGCGAGAGCAGCTGTGTTCTGCGAGTG
gtgaaacaattgcctgttgcattctatttataggcagaggtaactaaaaacctcagtgct
gagaggggcatcatatagatcctgcagttatgagctggttcacttggagttgttttggtt
gcaggtgacagaaagcacgactcaaggtagcatcaaccaaacagggaggtgggagcactc

 1.06 Intr +  17444  17604  161  1  2   47   57   108 0.319   2.90
ttgtctcaaaaaaaaaaaaaagaaagaaagtgcatcctctggtaggccttgggccggggg
cgggcatgagagagctgcgctgggatgcgctgccagggcacacttggtgggtcacacact
cttgtcaactgtttgggggctggagagtagtagcactcagctcacacgggccttctgcag
GGAGTGGTGGGAGGGCCTGTGAGTAAGGGCTCCGGAAGGCCCATCATTGGGACCTGGTGC
CGCCAGTGGGAGCAGGAGGAGCCTGTGCCTTCTCTGGCGCCAGTCATCCCAGATGCCACT
CAGGGCTTGGCTGGGTTTGCCAGCTCTCCAGGTTGGCACTG
gtaacgccaagatggtcctgggagcccatctccattcagcctcgagttccctggcttcac
tgagggaggagccgtgataaggtggctgtgggttcgcattttggactttgttatgtcaga
gtctgctgtgttttgtgtttatggtggcagctggatgagggccagcgacttcaggtgttg

 1.07 Intr +  18630  18731  102  0  0   84   78    78 0.488   6.19
ctctgggggccgaggggctctgggcctgcaccccctctgtagacacctggcgagtgtcca
ccccttggcccagctcctttcctcagttttcctcgggcgtgctcccagtgctttgtttgc
ttggctgtgggtggtgacccgcccatgctgtctggttgatttaactggtgtgtcttccag
CTACAAGAAGACTCAGGAAACTCTTTCACAGGCAGGACAGAAGACTTCAGCTGCCCTGTC
CACAGTGGGCTCTGCCATCAGCAGGAAGCTTGGAGACATGAG
gtgagacgcaaccctgactctgctgccctgagacctggccaggagtgaggtgaggtgttg
gaggtgctacaggaagcctgcctggagatcagggctcagatgcactggctcagggatgtg
gccatccatcatggccccgaccagtctgtgtgcagacccttgcctgggaggttcgtccat

 1.08 Intr +  19542  19634   93  0  0  110   82     3 0.350   1.48
cctgggtatgatgcttggctgggctacctcctggctgggcaccccagctgggcctcaggc
acgccttctttcacaggggttgtaggagtggatgatataggttgtcaccatcaacagcat
cctggccccaacttctgggtgctgctgcccaccctgccctgacccctttcccattctcag
AACTGGTCTTCTGGCTTTTGGATCTCAGGGAGTGCCTCCCTGTAGCTCTGACCCAATCCT
GGCAAAGATGGGTGCAGGCTTCCTAAAGGACCG
gtgtgtggagcacagtgctgaccccacccagccctcccctcttcccctcttgtggcccct
gcaggattcagagatacgtacatctcctgctgggctgcctgcctgcctgcctgcctgcct
ccctgcctgcctgccttaggttaggtgtgtcctgcctccccgcctgtggttgccaggtgg

 1.09 Intr +  21669  21860  192  0  0    0   68   134 0.196   1.73
acgggccgctctcgttctgtggagctggccaagcccagctgtcatgctgtggcacatttc
acacctttgcgctgctggatggggctggttgtgctccaggtgctgtggcttctccaaaca
ggtgtgccttggggcataaggcgtggacagggcgtggacccaggggcctcttgggcacag
CCGTGAGGCTGAGCAGTTGCTAGTCATGATCTTGCGAGAGCCTCCTGTTGAGTCAGGACT
TGAGGAGACTGGAGACAGTGCTGCTGTCCCCGGTGGTGTGCGGACTGGAGGAGCCGTCCT
GGAGGGTCTTCCCCTGCTGGGCCTGACTGAGCACGAGCAGGGGGCCTCCCCTGGGGCTCC
CCGAGGAGGGCT
gtgagtgggtgctggcctcccttgcttacacttcgtttcctcttctctcctgctgccacc
ttccagggctcatccattttcacactcctttaggtaaggctgagcctggacacacctgtg
gaagacttttctctgaattggggcagggtggactccggcagggcccttgggcggctgtgc

 1.10 Intr +  25101  25185   85  0  1  120   70    89 0.265  10.62
ctcacttttgacctggggagtctccggaatgacctggctgtctcacagttttgccatgag
atcttgggatgttgttagggaccctttggaggctggccctaaccctgaggcccttccgag
ttaggagagcagcacaaccctctcctcttgacaccgacactcttccctctctctttaaag
GAACTCTGCGACCTTCAAGTCGTTTGAGGACCGAGTTGGGACCATAAAGGTAATTGTACC
TGGACTGTTTGATGGTCTTGGCAAG
gtgtgacctgttacagcaacttgtttattattagtcatttagttatggtagactcacata
cagttgtgggaagtaatgcagagaggttccttgtgccttttacacagttctctcctgtga
cgacatcttggaaaatcctgtagtgcagcctccccaccaggacattggcactgactcagg

 1.11 Intr +  27207  27350  144  2  0   49   69    66 0.021   1.79
cgcaccccagcagcctctctcgcacaccggggccctgcatgtcagatggcgtggtctgca
gggggagctctgtgccttagtggctcttggcaggacactgagggcctgcctgtggtgtgc
ccggctctgccactcccgggaggggaagggctgctcagctcaaggtgtcctgttcggtag
AGCAAGTGTCCTCTGACAGCCGTGTCCCCGGACAGTTCAGACACCCTTGGGGATGGCACT
CCACACACGACAGAGATGCAGGGGCCAGGGAAGCCCAGCGCTCGGTGCCCTTCGTCCAGG
GTTAAAATCGGCCTGTGGGGTGTG
gtgagaaggcaggttgtgcgggtgttgaccgatgtatcttttccttaaagttattataat
aatgggtaatttgtcaataaagcattcctttgggggaaagtccgcctcggcttgtgtgat
gtatcgttcgggaccatgataagagtggtaaatgaactggcacacggtacctgccctaat

Predicted peptide sequence(s):


>TPD52L2_1|GENSCAN_predicted_peptide_1|501_aa
RHVGRSSHFPPSQSSRYSDRSTCDSRWWSQPGMDSRRTTPPFPGSPAVSAYQVESAPGAT
DLEAYDGRGVFFARGPDRFLGSLQPPSWSPLGPFRDINLNSPNKGLLSDSMTDVPVDTGV
AARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQ
NLSRSWHDVQILSAIGALEDGREGERGRWVEDSTGAWPHEAAMRPHSQWVMSECESSCVL
RVGVVGGPVSKGSGRPIIGTWCRQWEQEEPVPSLAPVIPDATQGLAGFASSPGWHCYKKT
QETLSQAGQKTSAALSTVGSAISRKLGDMRTGLLAFGSQGVPPCSSDPILAKMGAGFLKD
RREAEQLLVMILREPPVESGLEETGDSAAVPGGVRTGGAVLEGLPLLGLTEHEQGASPGA
PRGGLNSATFKSFEDRVGTIKVIVPGLFDGLGKSKCPLTAVSPDSSDTLGDGTPHTTEMQ
GPGKPSARCPSSRVKIGLWGV