GENSCAN 1.0	Date run: 16-Jan-104	Time: 01:09:22

Sequence TGM2_1 : 38475 bp : 52.89% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    506    562   57  1  0   93   70    47 0.603   2.97
gtctgcatgtctgtacctgagtccatgcctgcatgtgtgtctacctctgagtagccacat
ctttgtgtgtctgtgggtgccctctctgattttgcgtccacatctgacagtggcattggt
gtctaggaggtctgtgtgtgtgccaggtgcctctggacacctgctcatctgtgtccacag
CTGTGTGTGGCTCGCGGTCAAGGCTACCTGGCTGTGTCAGGCTGTATCTATGTCCTG
gtgtgtgtctgccattcgaatctgaatttgtatccatgtcactgtgtctgcgtggccagc
cgtgtttggtgtatctgtgggagtgtatctgtgtttgtgtgtgtatctccacagccctgt
cttggtgtgtctgcgtctgctctctgtgtatgtatatctgagtatgtgtgtgagtgtgtg

 1.02 Intr +    991   1040   50  0  2  106   80     9 0.733  -0.13
taagagtccacatctgtgtgtccaggtgcaccccggttccgttgtgtgtttctatgaggg
tgctgcgtgtgtctgtatctgagtgtgtgtgtccaggtgtctgttctccaaggtctgagt
ctgtgggtccaggtgtgtctgtatcctgggctagttgtgtgtccctgtccgctcccccag
GGGGCGCCCTCGTCCGGCCGCCGTCCCTCCCTCGGGCTCCGGTCCCCTGG
gtgagccccagcgctggcggcgtgggcccgggactgggcaatgggtggcctcccaggtcg
ccgccttcccgcggggccccgcccccggcccgccccaaagcgggctataagttagcgccg
ctctccgcctcggcagtgccagccgccagtggtcgcacttggagggtctcgccgccagtg

 1.03 Intr +   1177   1256   80  1  2   78   96    60 0.839   5.49
ccctcgtccggccgccgtccctccctcgggctccggtcccctgggtgagccccagcgctg
gcggcgtgggcccgggactgggcaatgggtggcctcccaggtcgccgccttcccgcgggg
ccccgcccccggcccgccccaaagcgggctataagttagcgccgctctccgcctcggcag
TGCCAGCCGCCAGTGGTCGCACTTGGAGGGTCTCGCCGCCAGTGGAAGGAGCCACCGCCC
CCGCCCGACCATGGCCGAGG
gtgagtatcagagtcaccgcagccgccactcaggggccccggggcattgggggtcaggac
ccggtgggagctgaatccctaagtcctgatttggagagcaacaggcagaccgggctgggt
gaggaggcgtctcaatgctgcttggagcctcagtttccccatccacactgcataaccatt

 1.04 Intr +   4846   5025  180  2  0  111  117   245 0.980  30.06
agattgggccccacctagcccccgtgtgaccagggctggggagacaggtcagtcgaaaca
atggctgtgctttgtggggagtaagagggcacaaggcccccatgtctagggagggcaggt
gcatcactggaggtctgaaggatgcccccgaggctcatgcgtctccttctgtttccatag
AGCTGGTCTTAGAGAGGTGTGATCTGGAGCTGGAGACCAATGGCCGAGACCACCACACGG
CCGACCTGTGCCGGGAGAAGCTGGTGGTGCGACGGGGCCAGCCCTTCTGGCTGACCCTGC
ACTTTGAGGGCCGCAACTACGAGGCCAGTGTAGACAGTCTCACCTTCAGTGTCGTGACCG

gtgagtacctgcaaccccactccaccaccaccaccaccaccaccacttcctctccacccc
gacatgccccagaaccctgacagagaacaggacaaataactttaccttctttgttccctg
ggagattgccacctgtcatcagccccattttagagatgagggaactgaggcccggaaagg

 1.05 Intr +  10356  10598  243  1  0  130   99   281 0.994  31.40
ctgagcccccctttacagatgaggaaactgaggctcagggagacaaacttcttgccaaac
ttatttcagtggttagtggcagaactaggcctggagcccaagctgggggaccccacgtag
gtgccctgccctgccagccctgctacccctagctcacggctactgcttctccctccacag
GCCCAGCCCCTAGCCAGGAGGCCGGGACCAAGGCCCGTTTTCCACTAAGAGATGCTGTGG
AGGAGGGTGACTGGACAGCCACCGTGGTGGACCAGCAAGACTGCACCCTCTCGCTGCAGC
TCACCACCCCGGCCAACGCCCCCATCGGCCTGTATCGCCTCAGCCTGGAGGCCTCCACTG
GCTACCAGGGATCCAGCTTTGTGCTGGGCCACTTCATTTTGCTCTTCAACGCCTGGTGCC
CAG
gtgagccacacgccatccactcacagcgttggggtgggcagggctggatccgcccatgga
ggaggctactggaggtgagaagaacaggggataagagacacacatcaaagtggactgagt
gaggcccactgtgctccagcctcacaaaaccctcaagacatgagtactcctgttatccct

 1.06 Intr +  15388  15506  119  2  2   91  110   173 0.961  20.49
ataacaccttatctcattgacgtgggattattcattaatggttactttttctaattaaaa
gaaggatggatccctgagacgctggcttggcctagggaattggcacccttgactccagat
ttgcagggaccctgggcctccgcagacccagagctgaggtccctttcttcctgcctgcag
CGGATGCTGTGTACCTGGACTCGGAAGAGGAGCGGCAGGAGTATGTCCTCACCCAGCAGG
GCTTTATCTACCAGGGCTCGGCCAAGTTCATCAAGAACATACCTTGGAATTTTGGGCAG
gtaagggccacaccctgtctctcccaaccatctcaggcccttctgtgtgcccggccctgt
gtctgggggcagccaaagctgcacaggtgggagtgagtcacagagtcacccacttcatgc
tgtcagggatgcaaaggccctgaaacagctgaaggttcagagagggccaaggctgccctg

 1.07 Intr +  18356  18484  129  1  0   89  101   210 0.546  23.80
ctccattccctcctgtgccaagagaagctgccaccagagagatttggtagactcggccgg
agtgtcccagtctgctgtgtgggacagagtgggaaacagctgctggaggcttcaacgcag
gcttcctggaggaggtgccttcccagctccctctttctcctcttgtttcctctgacacag
TTTGAAGATGGGATCCTAGACATCTGCCTGATCCTTCTAGATGTCAACCCCAAGTTCCTG
AAGAACGCCGGCCGTGACTGCTCCCGCCGCAGCAGCCCCGTCTACGTGGGCCGGGTGGTG
AGTGGCATG
gtgagtgagtggcatggcccatccaggggcggggcctacagggggctcccgcaggcctct
ccctcgcagtggagacacaggctaggcgcggtgggggacccgggagatgggtaagtcttg
gggaaaagaccttatattggaaagataagatttgcacagatgagggtgatgctatggggt

 1.08 Intr +  19551  19728  178  2  1   95   99   420 0.491  43.81
ccagcccccaccatctgccgcacaccagtctgtcacacgatggcccctttgcacctgctc
tttcctcaccctggagctcccctccccagctttcaccccctgctgtactcaggctcaccc
aggcggcacagccgacaccccatcccaggctcagtccccgtgctgccccactggttgcag
GTCAACTGCAACGATGACCAGGGTGTGCTGCTGGGACGCTGGGACAACAACTACGGGGAC
GGCGTCAGCCCCATGTCCTGGATCGGCAGCGTGGACATCCTGCGGCGCTGGAAGAACCAC
GGCTGCCAGCGCGTCAAGTATGGCCAGTGCTGGGTCTTCGCCGCCGTGGCCTGCACAG
gtgagctgcacgctgggatgtgggtcatgagccctgggagggggcacgaagagcactgga
gtaggaatcaggacatccctgccctggtcctgccccctgccaccaacactctcaatgcgc
tatgtggcctagagcctgtgaccaccctctccggtcctttatccaatagccatccctcca

 1.09 Intr +  23047  23160  114  2  0   81   42    54 0.639   1.02
tgtgctcctcgcctctctgagctgagctcagcttgcagatgccagtcaatgtcctgttgc
tgtttaacctgtcattgcaacatcagcccctttcccagcaaacagggcgttggcaggtat
gcagggccctccctccggacaagtctgaggaccctgatctgtgctgcgacctatttatag
GGCCACGTGCATCCGTGTTCTTGTACATTGGGAATGATGATGAGTCCTCAGTGGCATCAC
TAATGCACAAAGAGATGGAACCAAGGCCCAGAGACATGAAGGGACTGGTCCCAG
gtcacacagctgaaagcagctgggtctcccgacctctgtgccctcctctgcctgttctgc
tgtttgagtctttaagtccctatcttggggagagtcagtcattcaatcactccttccctc
cctccctctttcctctcctctctccttcctccactccttcatcccatttgacaaaatagt

 1.10 Intr +  24246  24381  136  1  1  105   81   250 0.995  26.13
gaatggacatggggtgaccagagaggtgggcgccattgtcccggcaggaagggctggctc
atgttctcagcacttggacagcaggtacagtgttccctggaatgcagatgggcaggtgga
ggcccagagcagggcggatgtctccaggacctcaccccgctttccactcctctccaacag
TGCTGAGGTGCCTGGGCATCCCTACCCGCGTCGTGACCAACTACAACTCGGCCCATGACC
AGAACAGCAACCTTCTCATCGAGTACTTCCGCAATGAGTTTGGGGAGATCCAGGGTGACA
AGAGCGAGATGATCTG
gtgaggtgggggccagggtgggatcggagcccagtagggagggccccatggagaggaaac
cttggagggcttcttggaggaggtcacatttgaattgggccttaaaagttcagcagtatt
tgagcaggcttggggaaggcctagagggaaagtcaaccacatacatgatggggcctcagg

 1.11 Intr +  25060  25163  104  1  2  107  100   135 0.999  16.92
gagggtgctgtgagatgggcccccgtggggggaagaacaaggcagtggggagacaccctg
ggctcagtttgggacgaggcgagcttgcatctggggacatgaatgcatggtctgcccgtg
ggaggtggcgatgaatgttgctcatgttctgcttcattcccgcccccctatccccctcag
GAACTTCCACTGCTGGGTGGAGTCGTGGATGACCAGGCCGGACCTGCAGCCGGGGTACGA
GGGCTGGCAGGCCCTGGACCCAACGCCCCAGGAGAAGAGCGAAG
gtgcgtgggcgggcactgtcgcgtcaaacagatggggaagacgaggcttggagagttaaa
gtgactcagctggagggcggcagaactaggagctcacccggagaccactgatgggtccac
agaagggtgggggacctcacttacatcttaataacacacttcttgataaatctcaaaaat

 1.12 Intr +  26791  27033  243  2  0   82   75   496 0.997  45.70
ctccagagcccctattctgaacccttgccctgtggtgccctcctggaagtggagtccttc
cgtcagagggccgcgtggtcttgaggtttttggctacatgtgattgaattgtggagcgtt
ttagaggacaccacccaaccttcacccaggcccatcccttcccctttctacctctgccag
GGACGTACTGCTGTGGCCCAGTTCCAGTTCGTGCCATCAAGGAGGGCGACCTGAGCACCA
AGTACGATGCGCCCTTTGTCTTTGCGGAGGTCAATGCCGACGTGGTAGACTGGATCCAGC
AGGACGATGGGTCTGTGCACAAATCCATCAACCGTTCCCTGATCGTTGGGCTGAAGATCA
GCACTAAGAGCGTGGGCCGAGACGAGCGGGAGGATATCACCCACACCTACAAATACCCAG
AGG
gtatgtgccctcagagtctttaatgcagccttgaagataagcatccagttttcccagccc
ggcaggctcgtgtatgtgtgtgcgtgtgttttaattggtagcctacgtacagcaatggcc
ccgtaggctatactccatcttcagcaatgccttagaaacaggagcaaacatgttgaggga

 1.13 Intr +  28060  28332  273  2  0   91   63   550 0.789  50.85
gagttcactagtggaaaattaatgaaatgctgtgtccttctggcccagaaatgtagagaa
ggggctccttcatggctgccctgagtcatcaggcctctgcgaagacagctcgccctgttg
cagcccccttcctgtgatctattccagctgtgattgaggctctcttctcaacccctacag
GGTCCTCAGAGGAGAGGGAGGCCTTCACAAGGGCGAACCACCTGAACAAACTGGCCGAGA
AGGAGGAGACAGGGATGGCCATGCGGATCCGTGTGGGCCAGAGCATGAACATGGGCAGTG
ACTTTGACGTCTTTGCCCACATCACCAACAACACCGCTGAGGAGTACGTCTGCCGCCTCC
TGCTCTGTGCCCGCACCGTCAGCTACAATGGGATCTTGGGGCCCGAGTGTGGCACCAAGT
ACCTGCTCAACCTCAACCTGGAGCCTTTCTCTG
gtaaagccctgtgttcctggagcatttgttgaccgccaactgacaacatgctaggtagtg
acctaaccacttagcatgtgtgatttcaccccacagacacttacatggcgctgactctgg
ggcaggccctgtcctaagcactttataaatatcaacccacttaattcttattgcaagagt

 1.14 Intr +  33945  34105  161  1  2  112   90   285 0.999  31.32
tctccagctcctcgctgggaaccctggagccacagtggggagttcagggatccgcccagc
cattcccccgctgtgtgaccccaagcacattccttcccctctctgtgcctcttggagttg
caagagagttgggaggggtgattctgcatcatgagcaccctcctttctccccttctgcag
AGAAGAGCGTTCCTCTTTGCATCCTCTATGAGAAATACCGTGACTGCCTTACGGAGTCCA
ACCTCATCAAGGTGCGGGCCCTCCTCGTGGAGCCAGTTATCAACAGCTACCTGCTGGCTG
AGAGGGACCTCTACCTGGAGAATCCAGAAATCAAGATCCGG
gtaagggcaggctgggcaaggggcagggtcccagggcagctcagcgctggggagagggca
gatccctacccccaccccacacacctgcatccctgcaagctccagacctttggtgcctta
gcgatcctcaaatcctagcctcatcgaagaaaagcatcatgaagcctagagaattgggga

 1.15 Intr +  35216  35352  137  1  2  108   95   246 0.999  27.17
tagcacaatcggtgttttcccgatgaagaaactgaggcacagaggtggggggaggggggg
tgatcgtggcagacctgggtacagctttgttcagcaaatattgggccaaattgcagtgaa
tgcagacagcccagcctggatcccacctgcccttgacatctgccccatgccctcttccag
ATCCTTGGGGAGCCCAAGCAGAAACGCAAGCTGGTGGCTGAGGTGTCCCTGCAGAACCCG
CTCCCTGTGGCCCTGGAAGGCTGCACCTTCACTGTGGAGGGGGCCGGCCTGACTGAGGAG
CAGAAGACGGTGGAGAT
gtaagtgctggctgctctagctttggggcctgggggaagcgggcagatgccggtgggggt
agagactgtccttaggtaccaagccctggctgaaaatcccctcctctcatctcccacaca
gctgtgcccactcccagacaccctggggctagagttcccaccgtcacattctctgtcaat

 1.16 Term +  36076  36226  151  1  1  138   49   254 0.999  24.19
cacaggcactgttcactctaggagggcagattgtccaggccccgcagagggccgagaatg
aggcccattcatggacacgctgtgctgatcctcggaggtcacgtgacttcctggctggac
cccagcatgcgggagccaggccttgggcccctttcctcaccaccccctctctccctgcag
CCCAGACCCCGTGGAGGCAGGGGAGGAAGTTAAGGTGAGAATGGACCTGCTGCCGCTCCA
CATGGGCCTCCACAAGCTGGTGGTGAACTTCGAGAGCGACAAGCTGAAGGCTGTGAAGGG
CTTCCGGAATGTCATCATTGGCCCCGCCTAA
gggacccctgctcccagcctgctgagagcccccaccttgatcccaatccttatcccaagc
tagtgagcaaaatatgccccttcttgggccccagaccccagggcagggtgggcagcctat
gggggctctcggaaatggaatgtgcccctggcccatctcagcctcctgagcctgtgggtc

Predicted peptide sequence(s):


>TGM2_1|GENSCAN_predicted_peptide_1|784_aa
LCVARGQGYLAVSGCIYVLGAPSSGRRPSLGLRSPGASRQWSHLEGLAASGRSHRPRPTM
AEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSV
VTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLEA
STGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPWN
FGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGRW
DNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTGPRASVFLYIGNDDE
SSVASLMHKEMEPRPRDMKGLVPVLRCLGIPTRVVTNYNSAHDQNSNLLIEYFRNEFGEI
QGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPTPQEKSEGTYCCGPVPVRAIKEGD
LSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSINRSLIVGLKISTKSVGRDEREDITHTY
KYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVGQSMNMGSDFDVFAHITNNTAEEY
VCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSEKSVPLCILYEKYRDCLTESNLIKV
RALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQKRKLVAEVSLQNPLPVALEGCTFT
VEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLPLHMGLHKLVVNFESDKLKAVKGFRNVI
IGPA