GENSCAN 1.0	Date run: 16-Jan-104	Time: 01:48:14

Sequence SYCP2_1 : 60873 bp : 32.55% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   2174   2317  144  1  0   43   61   105 0.378   2.86
aatttctaattcagttgttccaaatttaatagtggccatatttttaaaaaatacgtgaat
taatattttatgagttcatttgagagttttcatgtgaaaacggttctcaaattactagat
tgcataaggtaattaattttggttttgatacagtatgtgccattaaatatatttctctag
CAGTTGGAAAAATGCATTGATGATGCTTTAAGAAAAAATGATTTCAAACCTTTGAAAACA
CTTTTGCAAATTGATATTTGTGAAGATGTGAAGATTAAATGCAGCAAACAGTTTTTCCAC
AAGGTGGACAACCTTATATGCAGG
gtaaatattcatttttgctgaatgattgttacaattattagatagaactctagttttaga
aggaagtactccattagaaaaaaatgaataggcttgggcaagctcagtcataattatata
aataaatgcttatttcaccatttgcttattattgtttgtttgtttgaggaatctcaacac

 1.02 Intr +   4445   4469   25  1  1  102   70    32 0.357  -0.52
cagattgtataaagcatttattctggtaaatataattaaatggttagttaataaaaagta
attatgctctgagttaaaatgtaatctgtcatttcaataccatttgtaatggtttataat
attgtaatggtttgtaatatatagtaacttgtaaattaaatattattcactttttttcag
GTCATACATGATGTCAGTGATGAAG
gtataataaacacttattttctattggaacaataaattttactgttagagttttagtata
attttacaattcccattgtgttgtcctagtattaagaactcattatctgattcaaggatc
aacaaacttttactgtaaagggccagataataaatattttagactttgtagtccaagaga

 1.03 Intr +   9376   9518  143  2  2   70   98    73 0.275   5.65
tgttaattcctcaaatgatgagatatttctaatccatatgaagaaaatattaatagatta
atcaattacattaatatattcttatttctcttgcttattctaataccttgtaaaatatat
ggtcttttataaacttaattttcataattgtaaatcaaacattaactatttttttaatag
ATTATGACTTACAGGTAGGCATTGTAGAAGCTTTGTGTAGAATGACCACAGAAAAACAAA
GACAAGAACTGGCACATCAGTGGTTTTCAATGGATTTTATTGCTAAGGCATTTAAAAGAA
TTAAGGACTCTGAATTTGAAACA
gtaagttgtataacaataacagaaattcgtgaatttttaaaaattattatgatttttaaa
agtatttctctttaaaattaggattgcaggatatttctcaaccttgtaaatggcatgctt
ggagacaaaagaaggtaaacttaatgcaagatacaaccatttactgtcaaataaatagag

 1.04 Intr +  10571  10924  354  1  0   13   31   240 0.309   5.36
aactacctcatatgtttgtgatatagattaaaatgagataatatgctaactatgtaaaat
agtatctaagaaagaattctgtgaatttaaccatttttaatgtaattattcacttgtatt
cttatttaagttctatggaaacaataagctaagttaggaaactctgctcatatttgatag
CACACTGTATTAGTCTGTTTTAATACTGCTGATAAAGACATACTGGAGACTGAGACATTT
AAAAAAGAAAGAGATTTAATTGGACTTAAAGTTCCATGTGGCTGGGGAAGCCTCACTATC
ATGGCAGAAGGCAAGGAGGAGCAAGTCCCATCTTACGTGGATAGCAGCAGGCAAAGAAAG
AATGAGGAAGATGCAAAAGGGGAAACCCCTGATAAAACCATCAGATCTCGTGAGAGTTAC
TCACTACCGCAAGAACAGTGTGGGAGAAACTGCCCTCATGATTCTGTTATCTCCTACCAG
GTCCCTCACACAACACATGGGAATTATGACAGTACCATTCAAGACGAGATTTGG
gtggggacacagaaccaaaccatatcacacacaaaaacatttggtgcaatcattttagtc
agaatggtagattgagtagtattgtcaaagtaatatgattttctctacataaatgtccac
taaacatgtattttgaaaagtattaaagagggaaatatgattttatttcaattattatga

 1.05 Intr +  11782  11877   96  0  0   40   95    49 0.482   0.09
tattaaagtagcatttcatttgattgtttttaaatttatctaaatattatacttgtctgt
tctttctcttctctctccttctagctttgttttcttgctttagccatgaatataacatca
taattgtctgttatttctaaaatcattgtatattccagttttgtatgtttattttattag
CTGCAAATACCATCAGATGAAAAACTTGAGGAATTTTGGATTGATTTTAATCTTGGGAGT
CAGACTCTCTCATTCTACATTGCTGGAGATAATGAT
gtaagtttaatttggttggtattattctttatgtatatgcatatataagatttttactta
ctttaagaatgtggatttctttatatgttctagccagtctttacctagattttaatatta
gctctagtagtttgattagcatagcaacctaccaagctaattataaatgaaaactacttc

 1.06 Intr +  23343  23489  147  2  0   83   88    91 0.066   8.11
gagtttgaaaaaatggatactttttattggatcactttgtaaaaattataacagcacatg
gatagaaaagggaaataattgaatatgtgagatgagtaggagcttaagacatccagtgat
tgttgattactttctgtggtttgcagttttaaatactttttttttcatattctccaacag
ATTCTAGTGCCAGAAAGTCAAATCTCACCAGTCGGAGAAGAGCTCGTTAGTTTAAAGGAA
AAATCAAAGTCCCCAAAGGAATTTGCTAAACCTTCAAAATATATCAAAAACAGTGACAAA
GGGAATAGAAATAATAGTCAGCTTGAG
gtaaagatggtgtcaaaatactggcttataaaactaccattgatcaaatcactgttatat
atgagtactgaaagaagcatctagaatttatatattattggccttgatcaatcacatttc
agagtgtttctcctacctttgacaaatgcaaacaaaagatagtgtgtgtcttagcaaatt

 1.07 Intr +  27099  27198  100  2  1   69  103    49 0.069   3.26
aacatgaagatgaacctttcatatcagcctaaaacatggaaatttatgaatattgtgttg
tttatttaaaaaacatatatctttggcatgtatcaaggcaaaatgttataagtaaaattg
taggatatttaatttcaaaaagactgtgtttacagtggttgtttttcatcgtggtttcag
AAAACTACTCCTAGCAAAAGAAAAATGTCTGAAGCATCAATGATTGTTTCTGGTGCAGAT
AGATACACTATGAGAAGTCCAGTGCTTTTCAGCAACACAT
gtaagttttatagttttaaaagatttctaacaattattttaaaggaggcattttttaatt
taaggcaattctgaacataatttacataaaggataagtttggtgtataaaaattgataaa
atatgaaccacaaatgtcttctaatgggaagaaaagtataatgctaacatatgaacagaa

 1.08 Intr +  28030  28190  161  2  2   76   27   129 0.878   4.39
gcaaatttttccttcacttattatcttggtagatggcatctatattcacttaattatcta
agccagaaacctgggaaccatctaagaatgttcgtttcttacctttctcattggaaaagt
acctcaataatagcaataggtaaaaaaagaaaaatctgcaatccttgtcctcctttttag
CAATACCACCACGAAGAAGAAGAATTAAACCACCACTGCAAATGACGAGCTCTGCAGAGA
AACCTAGTGTTTCTCAAACATCAGAAAATAGAGTGGATAATGCTGCATCACTGAAATCTA
GATCATCAGAAGGAAGACATAGAAGAGATAATATAGACAAA
gtaactttaccttgaaagtattttaaaaatattttttcaagtaattgtggaaatatgtat
tgagctaactccttttgcaagctgcaagtgtctcattttgtttaaagcattacctttttt
cccctaaatatttattgcccttgaaagtagggtccttctggcatatgactcatttactgt

 1.09 Intr +  30034  30103   70  0  1   95   83    31 0.886   1.14
tgtgtttcaggatagggaatattcaaaaacgggcataacgtttatgaaatatataaaaat
agtatccaacttttcatatcaaggcagatttgttttaaaagactcaaaccttaatactgt
aacatttaggttttcatataacatcttaagtttacgttaacctgtttcctgtgtttacag
CATATCAAAACTGCTAAGTGTGTAGAAAACACAGAAAATAAGAATGTTGAATTCCCAAAC
CAAAATTTTA
gtaagtaccttgtggtttaatttagtcatttttttaagaaaatgtatatacttctccctg
tattaccatttaaccccactggctttcattgatttgaaaaagatttacaaagaatttgtt
tgactttgtgcaaggaatttttgaggttacaaggaaatataccacctttgttccccagaa

 1.10 Intr +  31201  31637  437  2  2   69   89   185 0.775   9.07
aaagagcaagtacttcgtcaggagacacattgaatcaaggtgaaacttagttttatctat
atgtaatagttcagtgttaatttcctcaaatgtctaacaagtattaaaacaaatttaaca
aattttacatatgtcaacttattaatttaaaaagaattaatttctcattttccccaatag
ATATTGTTATAAATAAAAAACTTACTAAACAAAAATCATCCTCTTCAATATCTGATCATA
ATTCTGAAGGAACAGGAAAAGTGAAATATAAGAAAGAACAAACCGACCATATCAAAATAG
ATAAAGCAGAAGTAGAAGTTTGCAAGAAACACAATCAGCAACAAAATCATCCTAAATATT
CAGGGCAGAAAAATACTGAAAATGCCAAGCAGAGTGATTGGCCTGTTGAATCTGAAACTA
CTTTTAAATCGGTTCTCCTAAATAAGACAATTGAAGAATCGCTGATATATAGGAAGAAAT
ACATATTGTCAAAAGATGTGAATACTGCTACTTGCGATAAAAATCCATCTGCTAGCAAAA
ATGTGCAAAGTCATAGAAAAGCAGAGAAAGAATTGACTTCTGAGCTTAATTCCTGGGATT
CGAAACAAAAAAAAATG
gtgagctttcaatgtgttttgatttctgcatatccataagatgcctacttgataacataa
gaaagaaagaaacttgattaattgctacacatttaacatgtgtaataccttgtttaattc
agtgcccagactctcagaattcctcactcacctctcccttgtcgtagctctgatagaaca

 1.11 Intr +  43156  43324  169  0  1   52   71    56 0.047  -1.10
gtgactttcttggataggttattaatgccatcctaaattaggatgttaagaaatgacaag
ttagttttcctgttttgggttttgtttttttttgttgttgttgttgttttggtttaactt
accttgcatgacataatgagatgtagtatttcttcatgcatttcaaacttttttttatag
ATTATAACAAATCATCAAAAGAAAAATCTGTTTAGTGATACTGAAACAGAGTACAGATGT
GATGACAGCAAGACTGATATTAGCTGGCTAAGAGAACCGAAATCAAAACCACAGCTAATA
GACTATAGCAGAAATAAAAATGTGAAGAATCATAAAAGTGGAAAATCAA
gtaagaaattatcttttggataaatgttgcaaatgattttgcagtttatttcaattattg
aaaatgctttatataagcttattgtatttagactgttcattactacatactttcatggat
aggacaaaacactagtttttatgttttttgttttattttagtaatacggttatatttatt

 1.12 Intr +  49566  49771  206  1  2   42   77   131 0.669   5.40
cagtcttacaaatattttaaatataacttggtcttaatatttttaaagctatcctttttt
atagctaagatttgaagatctgacaaattcttagaatttaaattaatcgtgctatttcta
aagcagacatcaatgataacgcttgccatctattttcttttttattttgatgcaatatag
GTATAGAGAAAATAACAGAAAAGGATTTTACTCAGGATTATGACTGCATAACAAAATCTA
TATCACCTTATCCAAAAACTTCATCACTTGAATCCTTAAATAGTAACAGTGGAGTTGGAG
GTACAATAAAGTCACCCAAAAACAATGAGAAAAACTTCCTGTGTGCAAGTGAAAGTTGTT
CACCAATTCCACGACCACTGTTTTTG
gtgagaatgtatatatatttttctctttatcagatatatctgaaggtagtaagttatttt
ccctatcatcttaatcagatacacattgcttgtctatttaaggttttgggtttggtctag
ggtcttgggggagagggacataatgacaagagagagatacttgccagtcttgatgaacct

 1.13 Intr +  53644  53829  186  0  0   67  107    65 0.932   5.26
aataatccacttgcctaaggattttttatttttagttatgaattggaattgaatttttgc
agtgaattagtagttttgcagttttgctttaatgtttcttatgttcaactctttttgaag
tggggggctttgaacaattttgtaacttcttattgggtttttgtatgtcttcattcatag
CCCAGACATACTCCAACTAAGAGTAATACTATTGTAAATAGAAAAAAAATAAGTTCTCTG
GTACTTACACAAGAAACACAAAACAGTAACAGCTATTCAGATGTAAGCAGTTATAGTTCA
GAAGAACGGTTTATGGAAATTGAATCTCCACATATCAATGAAAATTATATACAAAGCAAA
AGAGAG
gtaagtgtgggactataacttataaattttccttacactaagatggttcttataagactc
agattactgacctttagtggtaattataatattttaatgcttttcaactgttattacctg
aaaatctgatgtttaaagtatatagaatggcttgatcatagaaaaatattttttgataga

 1.14 Intr +  54702  54792   91  2  1   43   72    32 0.916  -4.25
caacttagaatcaaggttaacacatggtaaatattagagatgaaaaggaagggatagaaa
caatctgagaaagaattgacagcatttaaaattattggtttttgggtttgagaaaggtga
taaaatgtgaattgaaatatatttacggaatttttttctaatttctaatacgtattttag
GAAAGTCATTTAGCATCTTCATTATCCAAGTCTAGTGAAGGAAGAGAGAAAACGTGGTTT
GACATGCCCTGTGATGCTACTCATGTATCAG
gtttgtagtcatagtcttgctttttaaaaaatgattactgaaatgctacgtgacatttca
actaaaggaattatgtattttaagtcataccgttattcaacttaatgtaaaaagaaaata
aactaggtagaattgaatgcataattacctaaaacataataaaaatacttagtggaaaca

 1.15 Intr +  55059  55214  156  1  0   71   56   102 0.903   4.36
ataccgttattcaacttaatgtaaaaagaaaataaactaggtagaattgaatgcataatt
acctaaaacataataaaaatacttagtggaaacaaagcctttttaaaataaaagcaagaa
aatatgaggtatttttaatgaaaattgcagcgcttttaactttctttaactgttcctaag
GCCCCACCCAACATCTTAGTCGCAAAAGAATATATATAGAAGATAATCTAAGTAATTCCA
ATGAAGTAGAAATGGAAGAGAAAGGAGAAAGGAGAGCAAACTTGCTTCCCAAAAAACTGT
GTAAAATTGAAGATGCAGATCATCATATCCACAAAA
gtaggtagatcagtagcctgtatcaaaatgcagttatttggagggtggttcttatatttt
gaatgagtctatttacaaaacaaatttgtaaagacaactttggatatgtccaagatggat
gatgctttattgcaaagttcacatttatatgaataattgttgtagtaagggtcttagatg

 1.16 Intr +  55780  55916  137  2  2   75   82    69 0.880   4.37
tcagaataatctgatttttaaattaaaaaaaacataaggaactcttctgcctttgatttc
ataatccttaggttacacatagattcggaaaataagatagattttgttcttagcctaatt
acaaggctaaatttagagtaatgcatattttaacttcagcagattgttttcattttttag
TGTCTGAAAGTGTATCTTCATTATCAACAAATGACTTTTCTATTCCTTGGGAGACCTGGC
AAAATGAATTTGCAGGGATAGAGATGACTTATGAGACTTACGAGAGGCTCAATTCAGAAT
TTAAGAGAAGGAATAAT
gtgagttattctttaaattatgatttatacccaataatataataatatgccacactttct
actagaccattggcttgtttgatcctttggcaacaaaatatccattcatgaaaccaactt
tccttatatgtgaataattggaataaaatctgtatattacccgtattctttcttttgcta

 1.17 Intr +  58183  58239   57  0  0   83  115    25 0.758   2.86
taaaagtgtcttctgtaatactgatagtgaagaaactgtttttacatccgaggtataaat
tttatgctttttataggttacctctcttgattacaaaaagaatttgttaatgtaactttg
tctttgctgtgaaaactttatggtaaatttcatgggtgaaatatatttacttttttacag
ATGTGTTTGATGAAAGAAGATATGAAAGTGCTGCAAGACAGGCTTCTTAAGGACATG
gtaagtcaactaagtttgaaaatgggataatcatactttaatgtcttttgtttttgattt
ttttgtgtgtgtgcttttatgtctttctttttcttttgggttgagagaaaatagttttag
cccaattacttttagttctttaaataatgggagcatatttatagtgaaagaataggggta

 1.18 Term +  59239  59316   78  0  0   68   44    73 0.820  -2.32
agtaatgatcacagaattctgtggatatctgtagacctgttagaatgcaatatcttcatg
aaagaagttgttttaaaatgaatcactaataacagcttgatttttttttttctattttat
ttggtggttttacagcgaaaatgtgaaatctaagtgtgattttttttttcttggctatag
CTAGAAGAGGAGCTTCTTAATGTACGCAGAGAACTGATGTCAGTATTCATGTCTCATGAA
AGAAATGCTAATGTGTGA
aatctagtttttatcaccatactttatctaattattattctctgtatataactgaggaaa
taagaatagtcctacaaagagaaaaatatacatgtcaccgaagcaagtgtaccctttata
ggaaccctcaaattaaaaaaaaatgtcttttaatggatgagagggaaccactataacatg

Predicted peptide sequence(s):


>SYCP2_1|GENSCAN_predicted_peptide_1|918_aa
QLEKCIDDALRKNDFKPLKTLLQIDICEDVKIKCSKQFFHKVDNLICRVIHDVSDEDYDL
QVGIVEALCRMTTEKQRQELAHQWFSMDFIAKAFKRIKDSEFETHTVLVCFNTADKDILE
TETFKKERDLIGLKVPCGWGSLTIMAEGKEEQVPSYVDSSRQRKNEEDAKGETPDKTIRS
RESYSLPQEQCGRNCPHDSVISYQVPHTTHGNYDSTIQDEIWLQIPSDEKLEEFWIDFNL
GSQTLSFYIAGDNDILVPESQISPVGEELVSLKEKSKSPKEFAKPSKYIKNSDKGNRNNS
QLEKTTPSKRKMSEASMIVSGADRYTMRSPVLFSNTSIPPRRRRIKPPLQMTSSAEKPSV
SQTSENRVDNAASLKSRSSEGRHRRDNIDKHIKTAKCVENTENKNVEFPNQNFNIVINKK
LTKQKSSSSISDHNSEGTGKVKYKKEQTDHIKIDKAEVEVCKKHNQQQNHPKYSGQKNTE
NAKQSDWPVESETTFKSVLLNKTIEESLIYRKKYILSKDVNTATCDKNPSASKNVQSHRK
AEKELTSELNSWDSKQKKMIITNHQKKNLFSDTETEYRCDDSKTDISWLREPKSKPQLID
YSRNKNVKNHKSGKSSIEKITEKDFTQDYDCITKSISPYPKTSSLESLNSNSGVGGTIKS
PKNNEKNFLCASESCSPIPRPLFLPRHTPTKSNTIVNRKKISSLVLTQETQNSNSYSDVS
SYSSEERFMEIESPHINENYIQSKREESHLASSLSKSSEGREKTWFDMPCDATHVSGPTQ
HLSRKRIYIEDNLSNSNEVEMEEKGERRANLLPKKLCKIEDADHHIHKMSESVSSLSTND
FSIPWETWQNEFAGIEMTYETYERLNSEFKRRNNMCLMKEDMKVLQDRLLKDMLEEELLN
VRRELMSVFMSHERNANV