GENSCAN 1.0	Date run: 16-Jan-104	Time: 00:57:56

Sequence SRMS_1 : 9094 bp : 64.67% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1242   1597  356  2  2   72   84   348 0.964  29.55
gtgggaaccgtgtgcctcctggatccaggggacctctgagtgaccgcagggccggggtcc
cctgtcaccccacggccagggcagggagcgctggacaccgggtcccaccggccctgccag
ttcctcttccgggctcgcgggctcccatggccctcgggcccagcgtggtgaccccggggg
ATGGAGCCGTTCCTCAGGAGGCGGCTGGCCTTCCTGTCCTTCTTCTGGGACAAGATCTGG
CCGGCGGGCGGCGAGCCGGACCATGGCACCCCCGGGTCCCTGGACCCCAACACTGACCCA
GTGCCCACGCTCCCCGCCGAGCCTTGCAGCCCCTTCCCTCAGCTCTTCCTTGCGCTCTAT
GACTTCACGGCGCGGTGTGGCGGGGAGCTGAGTGTCCGCCGCGGGGACAGGCTCTGTGCC
CTCGAAGAGGGGGGCGGCTACATCTTCGCACGCAGGCTTTCGGGCCAGCCCAGCGCCGGG
CTCGTGCCCATCACCCACGTGGCCAAGGCTTCTCCTGAGACGCTCTCAGACCAACC
gtgagtacctcggcctcggagtcagagcctgcctcgcccccagctggggagtccagaaca
acggcaggattttgagttggaaatcgcatgtccgtggctatctgttcattcattcgttca
tccacgcattcattcagggacagctgatgggccccgggccggcaggtgtggtaggaaaac

 1.02 Intr +   4357   4478  122  1  2   93   82   163 0.889  17.51
ggccggcactgggggctgaggcagtgcagaccttgagctgggactcaaagtccacggggt
ggaccttctccctgaggcggtgggacagccgggctcagccctgccggcaacacggaggag
agcatgtggggccactggctgaggggcctgcaaggtgactgccgcacctgctgtttgcag
CTGGTACTTTAGCGGGGTCAGTCGGACCCAGGCACAGCAGCTGCTCCTCTCCCCACCCAA
CGAACCAGGGGCCTTCCTCATCCGGCCCAGCGAGAGCAGCCTCGGGGGCTACTCACTGTC
AG
gtacctggggcggcccctcctgcctctgtcccccaccaggtcagtggcccttgaccttgg
ggtggttggtctctaggcagtgctggctcctgattcacacccggcgccactgagggccca
acagcagatatgctggtcacctcctgcacttgctaactcacccatttattcattcattca

 1.03 Intr +   5225   5391  167  0  2   47   80   296 0.995  25.58
tgccccgccccagcctgtggctgcccacactccctcctccacacagctctgaccatctca
gggtccccagctaggtctgagccagaccccttagtgggttgtggccagcatcctctgggg
tgggagggtcggggcagctggcagccaaggcaggggtctccatctctgaacccttcctag
TCCGGGCCCAGGCCAAGGTCTGCCACTACCGGGTCTCCATGGCAGCTGATGGCAGCCTCT
ACCTGCAGAAGGGACGGCTCTTTCCCGGCCTGGAGGAGCTGCTCACCTACTACAAGGCCA
ACTGGAAGCTGATCCAGAACCCCCTGCTGCAGCCCTGCATGCCCCAG
gtgggcctgtgcctgccaagctgccccatgctgggcccgaggcatggccctgttctaggt
gctcctccccaccccgtcacaaaacccctggggctgtcagaggcgcagctccagggccct
gcccaggcctgggagcatcggagcatcccagcggttccagcacattctgctctctgcggg

 1.04 Intr +   6124   6265  142  0  1   97   94    91 0.997  11.71
ctcccacggggctgggccgggcctccaagcctggcacccactcccctttgtcccagccag
ggtggggtgagtgtgtgctggggacaggggtgcccgccagaggcctggtgtggggggctg
tgcctgggacagagcacaggggcccacgctgaccagcctccctgcccaccctccctgcag
AAGGCCCCGAGGCAGGACGTGTGGGAGCGGCCACACTCCGAATTCGCCCTTGGGAGGAAG
CTGGGTGAAGGCTACTTTGGGGAGGTGTGGGAAGGCCTGTGGCTGGGCTCCCTGCCCGTG
GCGATCAAGGTCATCAAGTCAG
gtgaggccccgagatcctgcgccacggccgggccccgcacctgctgtccaaccctcaagc
cccagggcagtgatgttcgtggcgtgggccggtcctggagccacaccctctctcgcagcc
aacatgaagctcactgacctcgccaaggagatccagacactgaagggcctgcggcacgag

 1.05 Intr +   6384   6542  159  1  0   48   73   358 0.996  31.45
ggaggtgtgggaaggcctgtggctgggctccctgcccgtggcgatcaaggtcatcaagtc
aggtgaggccccgagatcctgcgccacggccgggccccgcacctgctgtccaaccctcaa
gccccagggcagtgatgttcgtggcgtgggccggtcctggagccacaccctctctcgcag
CCAACATGAAGCTCACTGACCTCGCCAAGGAGATCCAGACACTGAAGGGCCTGCGGCACG
AGCGGCTCATCCGGCTGCACGCAGTGTGCTCGGGCGGGGAGCCTGTGTACATCGTCACGG
AACTCATGCGCAAGGGGAACCTGCAGGCCTTCCTGGGCA
gtgagtcccctccctgctgccacgtggccctgacgcgcctgcgaccgccccttccctcct
ggcgcagagctgaacctgcggggtttccgaggtgaaccgggcctctctaccgggagcagg
tggccccggctgcagatcccatccctgtctggtctccagccaacagggggctggcgtcag

 1.06 Intr +   7085   7266  182  0  2   84   82   354 0.547  35.19
tgagtacaggaccctcgccctgtctcacttggggcttcccgtggccttagccggccatgc
catcctcgccacgtcttagagatgaggaggctgaggcatgggggaaggtgacgtgggtgg
acgctggcctcaccggccgttggccccgtgccctaaaagaccccgcgctgtctcctgcag
CCCCCGAGGGCCGGGCCCTGCGTCTGCCGCCACTCCTGGGCTTTGCCTGCCAGGTGGCTG
AGGGCATGAGCTACCTGGAGGAGCAGCGCGTTGTGCACCGGGACTTGGCCGCCCGGAACG
TGCTCGTGGACGACGGCCTGGCCTGCAAGGTGGCTGACTTCGGCCTGGCCCGGCTGCTCA
AG
gtcagcggaggctctgggcccctgacccagagggggtgggtgaggggaccccggtccacc
tgccctaccaggggccttccctcgcccccaggacgacatctactccccgagcagcagctc
caagatcccggtcaagtggacagcgcctgaggcggccaattatcgtgtcttctcccagaa

 1.07 Intr +   7358   7514  157  1  1   91   98   278 0.996  29.87
tgcaccgggacttggccgcccggaacgtgctcgtggacgacggcctggcctgcaaggtgg
ctgacttcggcctggcccggctgctcaaggtcagcggaggctctgggcccctgacccaga
gggggtgggtgaggggaccccggtccacctgccctaccaggggccttccctcgcccccag
GACGACATCTACTCCCCGAGCAGCAGCTCCAAGATCCCGGTCAAGTGGACAGCGCCTGAG
GCGGCCAATTATCGTGTCTTCTCCCAGAAGTCAGACGTCTGGTCCTTCGGCGTCCTGCTG
CACGAGGTTTTCACCTATGGCCAGTGTCCCTATGAAG
gtgggtccccaggcagccagagggaggatgcaggctctgcccaggagtcactggccccgg
gcctggacgctgtcggcaaggggttggagggtctggccaagggcaggcagatgacatggg
gggctacaggaggcctcctccatagggacccccaggcagaatcgaggcagctcttgcccc

 1.08 Term +   7706   7887  182  0  2   51   47   287 0.999  19.64
ggcagccagagggaggatgcaggctctgcccaggagtcactggccccgggcctggacgct
gtcggcaaggggttggagggtctggccaagggcaggcagatgacatggggggctacagga
ggcctcctccatagggacccccaggcagaatcgaggcagctcttgccccgcgcctcccag
GGATGACCAACCACGAGACGCTGCAGCAGATCATGCGAGGGTACCGGCTGCCGCGCCCGG
CTGCCTGCCCGGCGGAGGTCTACGTGCTCATGCTGGAGTGCTGGAGGAGCAGCCCCGAGG
AACGGCCCTCCTTCGCCACGCTGCGGGAGAAGCTGCACGCCATCCACAGATGCCACCCCT
GA
gtcctcacgtgacccaacgctctgggctccagccaggccagcccctcctccctgcagagc
gccaactcgaagggatgccggtctgccggaccgaggagcctctggctgtgggcctcaggc
cctggcgtgcacacatgttcgtgcaccaggcagacgtgcagacggagggctggggctgac

Predicted peptide sequence(s):


>SRMS_1|GENSCAN_predicted_peptide_1|488_aa
MEPFLRRRLAFLSFFWDKIWPAGGEPDHGTPGSLDPNTDPVPTLPAEPCSPFPQLFLALY
DFTARCGGELSVRRGDRLCALEEGGGYIFARRLSGQPSAGLVPITHVAKASPETLSDQPW
YFSGVSRTQAQQLLLSPPNEPGAFLIRPSESSLGGYSLSVRAQAKVCHYRVSMAADGSLY
LQKGRLFPGLEELLTYYKANWKLIQNPLLQPCMPQKAPRQDVWERPHSEFALGRKLGEGY
FGEVWEGLWLGSLPVAIKVIKSANMKLTDLAKEIQTLKGLRHERLIRLHAVCSGGEPVYI
VTELMRKGNLQAFLGTPEGRALRLPPLLGFACQVAEGMSYLEEQRVVHRDLAARNVLVDD
GLACKVADFGLARLLKDDIYSPSSSSKIPVKWTAPEAANYRVFSQKSDVWSFGVLLHEVF
TYGQCPYEGMTNHETLQQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLREKL
HAIHRCHP