GENSCAN 1.0	Date run: 16-Jan-104	Time: 01:00:45

Sequence RGS19_1 : 8728 bp : 63.68% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1341   1419   79  0  1   92  105   -19 0.133   0.91
gggacaccctgtccgcccccgcccccaccccgctggatctggcagccactcagcccttcg
agctgtaggggaggcgctgcgcccccggccccagccgatcgggggctcctggcgctagcc
tccctccagagcgccgcaggagtccctcctgccgtctgacttgagtccctgctgctgcag
TGCACGCCCCTTCGGCAGCCAGGGTGGGGCCCAGACCCAACCTGGCCCCTCCTGCCCCCA
CCCCGCCTTTGGGTCGCTG
gtgagtagggagctttgaggtaggggtgggggcgtcagaggctgaagaaagaggcacctg
gaggagaacacaggcttctccagactggaccctaacagcagagagaggagcgtggtgggt
gggccaccaccaccatttcagaggtggggagagctggccttccctggaggggccaggcca

 1.02 Intr +   4067   4188  122  1  2   73  105    33 0.532   3.97
cctgggggagatggggtggggcaagctgaggggccacaaggagctgggagatccctgaac
acccgggaggccagaagggtcatgtgcctgggaacagggctacccatgggaaggtggggg
agaggtggagagtctggtgggttctgacctgaaagctgaggtagccccacttttccccag
ATCACAGGGCCAGAGGAGGCGGACCGGCCCCCTTCAATGTCCAGTCATGATACAGCCTCT
CCAGCGGCCCCCAGCCGCAACCCCTGCTGCCTGTGCTGGTGCTGCTGCTGTAGCTGCTCC
TG
gtgagtagggcctggggtgcccagctggcgagggggtcgagggcatggggccaagcagac
ccaggaggggacccagtggtggcttccgaggcatccccgcaggcaggatgcccctgccac
ctcacagcactgtcctgtccagggtctgttgggccctggtgatgagtggccggtgccttg

 1.03 Intr +   6172   6246   75  1  0   78  101     4 0.575   0.48
aagagccagctccaggggctgccctcctgcagtgggtgcccatgtgtgtcaggtgcctgc
aggggctgccctcctgcagtgggtgcccatgtgtgtcaggtgcctgcccatgtgctgagg
gcctgtgtggccgtggaggcgtgtgtgcccacggcagcgctgcttcctctctgccactag
GAACCAAGAGCGGCGGCGCGCGTGGCAGGCCTCCCGGGAGAGCAAGCTGCAGCCCCTCCC
CAGCTGTGAAGTATG
gtgagtccagccggctggtgtgtgcgtgctgggggggccccagaccgggagactcgggcc
tgacatagcctggcccccgtgcccacagtgccacgccaagtcctgaggaggtgcagagct
gggcgcagtcttttgacaagctgatgcacagcccagcgggacgcagcgtgttccgggcgt

 1.04 Intr +   6335   6569  235  2  1   94   69   400 0.998  37.62
ttcctctctgccactaggaaccaagagcggcggcgcgcgtggcaggcctcccgggagagc
aagctgcagcccctccccagctgtgaagtatggtgagtccagccggctggtgtgtgcgtg
ctgggggggccccagaccgggagactcgggcctgacatagcctggcccccgtgcccacag
TGCCACGCCAAGTCCTGAGGAGGTGCAGAGCTGGGCGCAGTCTTTTGACAAGCTGATGCA
CAGCCCAGCGGGACGCAGCGTGTTCCGGGCGTTCCTGCGGACAGAGTACAGCGAGGAGAA
CATGCTCTTCTGGTTGGCCTGCGAGGAGCTGAAGGCCGAGGCCAACCAGCATGTGGTAGA
CGAGAAGGCGAGGCTCATCTACGAGGACTACGTATCCATCCTGTCCCCCAAGGAG
gtgcgccagacaccagaacaggccgggggccgcctgctccaggcactaggtggggaaggc
agctcccgcaccccctgacctcagtgtcttgtcctgcaggtgagcctggactcccgtgtg
cgggagggcatcaacaagaagatgcaggagccgtccgcacacacgttcgacgacgcgcag

 1.05 Term +   6669   6860  192  2  0  124   47   366 0.998  34.49
gccgaggccaaccagcatgtggtagacgagaaggcgaggctcatctacgaggactacgta
tccatcctgtcccccaaggaggtgcgccagacaccagaacaggccgggggccgcctgctc
caggcactaggtggggaaggcagctcccgcaccccctgacctcagtgtcttgtcctgcag
GTGAGCCTGGACTCCCGTGTGCGGGAGGGCATCAACAAGAAGATGCAGGAGCCGTCCGCA
CACACGTTCGACGACGCGCAGCTGCAGATCTACACGCTCATGCACCGGGACTCCTACCCC
CGCTTCCTCAGCTCTCCCACCTACCGTGCCCTGCTGCTGCAGGGGCCATCACAGTCCTCC
TCCGAGGCCTAG
gccgcccccagcagcacagaccccgccgcctcctacggccgactctgggttcccttcagg
tgttgttgtcggcagggctgtcagggcacatgcctggccggctggggtccccacccgcgg
agacggtcctagacccagtggggagtgctgtgtctcctgggtctgcccacccgtggccaa

Predicted peptide sequence(s):


>RGS19_1|GENSCAN_predicted_peptide_1|234_aa
XARPFGSQGGAQTQPGPSCPHPAFGSLITGPEEADRPPSMSSHDTASPAAPSRNPCCLCW
CCCCSCSWNQERRRAWQASRESKLQPLPSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSV
FRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVRE
GINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSEA