GENSCAN 1.0	Date run: 16-Jan-104	Time: 02:36:54

Sequence MYH7B_1 : 6493 bp : 55.46% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1019   1081   63  1  0   65   24    90 0.320   1.40
ggctgggggggctgtgacacgtggagattgctgacatagctctcctcctctgaccttgac
agtggcaataaaaggggtagcagagcttcctgccctcaccgtggtgccgaggtaggtgat
cagggctggggttggagccgaagggagggcaggagggtgggcgggtgggtgagggtgccc
ATGGGTGGCCGCGAGTCTTCTGAATCTGGAGTGGAGGAAGCCCTGGTGTTTGAGGGTGTG
CAT
gtatgctgggcactcacccaaggaggctgcattgggagccagagggagtcgcctagtatc
tggtcttgtgggttgggggatcgtgccctagttcagctcccttgtcactgccatcttcca
gtgcctgctgccttgggccgccttgaacctccagggtttccagctcctcctccttcaccc

 1.02 Intr +   1236   1365  130  2  1   69  127   142 0.290  16.97
aagccctggtgtttgagggtgtgcatgtatgctgggcactcacccaaggaggctgcattg
ggagccagagggagtcgcctagtatctggtcttgtgggttgggggatcgtgccctagttc
agctcccttgtcactgccatcttccagtgcctgctgccttgggccgccttgaacctccag
GGTTTCCAGCTCCTCCTCCTTCACCCCAGTGCCACTGCCATGATGGATGTGAGTGAACTT
GGGGAGTCTGCCCGCTACCTCCGCCAGGGCTACCAGGAGATGACGAAGGTGCACACTATC
CCATGGGACG
gtaagtggagacagagggggaggggtcatagccacagagatgcccttatggactcagacc
aggaattgggaggggtggcaccagctcagggctgaaggggcattggggcctgacagctgg
agccctggacctttcctgcagagtctggggcctggaaattaaaaccccagggacactgta

 1.03 Intr +   2659   2765  107  2  2   68   20   200 0.991  11.63
ctcccagctccgcccttcctgagcctgggtttggagggttcttcactggaactcctgggt
cctggcagaggggctttggggagggtcacagctgtatggataccatggcttgggaactcc
agctagaacctggaggtgcctcagcccctctctgagtccagagctctctctgcaacccag
GGAAGAAGCGAGTCTGGGTGCCTGATGAACAGGACGCCTACGTGGAGGCCGAGGTCAAGT
CGGAGGCTACCGGGGGCAGAGTCACCGTGGAGACCAAAGACCAGAAG
gttccgttccccctttcctgagattagcctctctgtccctaggcctcctggccaacagga
tctgccctctggttgaagggggtctgggtatgtgggtgggggtgacaggtgaggtcggtc
ggttcctcccggtcccccggcccctgacacgatctccctggtaggtgctgatggtgcgtg

 1.04 Intr +   2930   3073  144  1  0   85   47   282 0.999  24.79
gaccaaagaccagaaggttccgttccccctttcctgagattagcctctctgtccctaggc
ctcctggccaacaggatctgccctctggttgaagggggtctgggtatgtgggtgggggtg
acaggtgaggtcggtcggttcctcccggtcccccggcccctgacacgatctccctggtag
GTGCTGATGGTGCGTGAAGCCGAGCTGCAGCCCATGAACCCGCCTCGCTTCGACTTACTG
GAGGACATGGCCATGATGACGCACCTGAACGAGGCCTCTGTGCTGCACAACCTGCGCCAG
CGCTATGCCCGCTGGATGATCTAT
gtgagccccaggcccgggccatgggcggggtggggcttgtatgtggggcggggctagaga
tgaggtgctgggggcgggcccatagcggtggggcggggctgtgagcggtggatcggggct
gtgaatgatagagcgggtccatagcgggggtggggctgtgagcgatgaggcggggctctg

 1.05 Intr +   3847   4003  157  0  1   84   64   189 0.982  16.20
aattagccggtcgtggtggcacgcgcttgtagtcctagctaccctgggaggctgaggcag
gacccaggaggcggaggttgcggtgagccgagatcatgccgttgtactccagcctgggag
acagagcaagactccatctcaaaaacaacaacataaaccctacctatactctctcttcag
ACCTACTCAGGCCTCTTCTGTGTCACCATCAACCCCTACAAATGGCTCCCAGTCTATACG
GCCTCCGTAGTGGCTGCTTACAAGGGAAAGCGCCGCTCAGATTCCCCGCCCCATATATAT
GCGGTGGCGGACAACGCCTACAACGACATGCTGCGCA
gtaagggccgcctggactcctccccaaccgcagaccccgacctcggtcccgggaggcctc
tgtaagggacccccttcccccactggcactgccccccttttgacgctgctggacatggtc
gcccagccgttctgtccctccgcatgggagctgacctccactagggacagccccacctgc

 1.06 Intr +   4302   4329   28  1  1  130   94    37 0.526   6.16
tcgcccagccgttctgtccctccgcatgggagctgacctccactagggacagccccacct
gctccttcccattcctggctctgggtggtggggtctgccccagatggatacccagggtgt
tccacctgtggctggccccacaccttggctgacttctctatccccttccctttcctccag
ACCGAGACAACCAGTCCATGCTGATCAC
gtgagtgtggggctctgggggtggggtggaaaatgctggccatctggcagaaagagggcg
gtaccacagtcatttcccaggattgaatccaaagtgcttaggccaggacttttaccacct
ggagctagtgtcccagctgaagctaaattaggcctgagcactttccctgcccccattctg

 1.07 Intr +   5728   5824   97  1  1   44   60   118 0.473   5.11
catctcacagggatggtctacactggcttgctttgtacacctctgagggttgatccatcc
ttgggggtttcaagctggggggaaggagaggtggagggctctgcttgaggggtgaggcat
tgggggtgggggagaattaggccagatgggcattggtgactcatgtttgtgtcgtccaag
CGGAGAGTCGGGGGCCGGTAAGACGGTTAACACCAAGCGGGTCATTCAGTACTTTGCCAT
CGTCGCTGCCCTGGGAGACGGGCCGGGCAAGAAGGCC
gtaagacttgcccactcgggcatgctccccgttgcttctcgctgtttttcttttctttct
tcctctcttttttttttttccccctttttaaaaattttactccccagaaccctgagccct
gcctgagcctcccaccctggtgggggactctggcctgagcaaggcttgaccacaaaggct

Predicted peptide sequence(s):


>MYH7B_1|GENSCAN_predicted_peptide_1|242_aa
MGGRESSESGVEEALVFEGVHGFQLLLLHPSATAMMDVSELGESARYLRQGYQEMTKVHT
IPWDGKKRVWVPDEQDAYVEAEVKSEATGGRVTVETKDQKVLMVREAELQPMNPPRFDLL
EDMAMMTHLNEASVLHNLRQRYARWMIYTYSGLFCVTINPYKWLPVYTASVVAAYKGKRR
SDSPPHIYAVADNAYNDMLRNRDNQSMLITGESGAGKTVNTKRVIQYFAIVAALGDGPGK
KA