GENSCAN 1.0	Date run: 16-Jan-104	Time: 01:07:21

Sequence GHRH_1 : 8203 bp : 49.51% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1201   1283   83  0  2   50  115    30 0.554   2.41
aggtctgtctgacttccagtgtctgggttctttttcccatcccacagcttccaaaaacca
aggaccaaggcttgccatggagccaagcccagggctgggccagtgaaggccatcccaatg
gctgtggctgtacctgaccttcccctcctgtcactctgcaggtgccaccccgggtgaagg
ATGCCACTCTGGGTGTTCTTCTTTGTGATCCTCACCCTCAGCAACAGCTCCCACTGCTCC
CCACCTCCCCCTTTGACCCTCAG
gtaagcagaccctggggaaagttcccaccactcccaagccatccctgccatggggcaggc
gttagtgaatgcagactcagcccatcagctgggccctggctatgtctccaggcagcaccc
actgcccgtccttgcagaggaggcagacacagcttcacagaggtcactcagaggggtctg

 1.02 Intr +   1592   1696  105  2  0  106   86   218 0.897  22.73
tccttgcagaggaggcagacacagcttcacagaggtcactcagaggggtctgagtctctc
ttggggtgagtgggacagatggcaacagaaggatcttgcagagacatggcgagtgcagcc
acgactgtcctctcgcctggcctccaccccgccctctgacccctgactccttccgcacag
GATGCGGCGGTATGCAGATGCCATCTTCACCAACAGCTACCGGAAGGTGCTGGGCCAGCT
GTCCGCCCGCAAGCTGCTCCAGGACATCATGAGCAGGCAGCAGGG
gtaagcaggagttctagtgatttcttcccacaccctgcagcagagtctgcaggagcttgt
tccctacaggggaccagggaccaattcagatctcttccttggcacagcaagtgtcatttc
tggacttcccatagcaaaagggttccagcgttaaacctcaacttacctccatgcctacca

 1.03 Intr +   3761   3880  120  2  0   54   80    95 0.518   4.91
gtgtacacttgtacttctgtgctcttcattactatatatactgcctccctaagtgtggct
gaatctaattcagttgggtagaagagtccacaccagatattgaaataggcatagggatat
acccctgcctttccacatcctacccaaatagcaactagttctctttttctaaccacacag
AGAGAGCAACCAAGAGCGAGGAGCAAGGGCACGGCTTGGTCGTCAGGTAGACAGCATGTG
GGCAGAACAAAAGCAAATGGAATTGGAGAGCATCCTGGTGGCCCTGCTGCAGAAGCACAG

gtatgggtgtgtgtgcatgggtgcatctagggacttcagggcttcctaccccgtggtttg
ccaggaaaaggaaaaaatccactcctctctgaaggtatggggctctgccaaacaaaccaa
gaacaaggaccctcctgacagacattaagaactaggagagtggctgggtatggtggctca

 1.04 Term +   5743   5800   58  1  1   55   48    84 0.384  -1.74
ccctaagtgctgggattacaggcatgagccaccgcacccggcctagagcctgatttaact
gcgagcacaagcaggtcccagtgtggctctgctgggcacttctggtccaagctattaagc
aaatccagttcccagcagagcgctccatggcctctctcaccttcttcccaacccgattag
ACACCACCAGCCCAGAGATTTCACCACCTACAAGCAGCACCAGGCCTACGGCAGATGA
caggagaggcgacaaccagtctgggaggcgggaagaacacctgggccccaggcctgtttc
tgcaactagcggcacagcaacacacttcttcgtttcgactctgtgaaaggaggggttagc
tcttaccatctctagggtccgcaagacaagagttcaaaaataatgtctctaagaagaagg

Predicted peptide sequence(s):


>GHRH_1|GENSCAN_predicted_peptide_1|121_aa
MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSR
QQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHRHHQPRDFTTYKQHQAYG
R