GENSCAN 1.0	Date run: 16-Jan-104	Time: 02:18:41

Sequence CST3_1 : 6680 bp : 57.59% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1276   1518  243  0  0  106   96   627 0.993  61.22
ttccggaaaagggagtgcaggccgcggtggggtggggcggcgaaggccggaagggataaa
accgcagtcgccggcctcgcggggctcacggcctcgcctcggtatcgcagcgggtcctct
ctatctagctccagcctctcgcctgcgccccactccccgcgtcccgcgtcctagccgacc
ATGGCCGGGCCCCTGCGCGCCCCGCTGCTCCTGCTGGCCATCCTGGCCGTGGCCCTGGCC
GTGAGCCCCGCGGCCGGCTCCAGTCCCGGCAAGCCGCCGCGCCTAGTGGGAGGCCCCATG
GACGCCAGCGTGGAGGAGGAGGGTGTGCGGCGTGCACTGGACTTTGCCGTCGGCGAGTAC
AACAAAGCCAGCAACGACATGTACCACAGCCGCGCGCTGCAGGTGGTGCGCGCCCGCAAG
CAG
gtgcgtgccgccccccgcagggtccgaagccccggccccgccgtcccagcctccccccgc
gctgctcccggaccccgtgctgctcctctccggcgcctgggcttctcacccggaccctgt
tcccggtcttcgctgtcacccccgagcccttggcgggcgtgtccgggaatgccctgagtc

 1.02 Intr +   1568   1730  163  1  1   35   62   130 0.770   5.84
gccccatggacgccagcgtggaggaggagggtgtgcggcgtgcactggactttgccgtcg
gcgagtacaacaaagccagcaacgacatgtaccacagccgcgcgctgcaggtggtgcgcg
cccgcaagcaggtgcgtgccgccccccgcagggtccgaagccccggccccgccgtcccag
CCTCCCCCCGCGCTGCTCCCGGACCCCGTGCTGCTCCTCTCCGGCGCCTGGGCTTCTCAC
CCGGACCCTGTTCCCGGTCTTCGCTGTCACCCCCGAGCCCTTGGCGGGCGTGTCCGGGAA
TGCCCTGAGTCTGGCCTGGCCTGGAACCGCACGGACACGTCAG
gtccgcgcccggcgcctaagatcagcttccaggagccagctcgagctgcgccgcagcgcg
ggggcaggcacaggacgtcccacacagctctgtcccgacctcctgggacgctgggctccg
ggtgcgctgctgaatacgcaggagaaggaaaaacagagcccctcatctggctgcctcctt

 1.03 Intr +   2087   2112   26  0  2  111    6    15 0.201  -5.53
ccttgttcttccaccaaataatttttaagcacttttgtttcttttaactttttattctcc
cgtaatttcagacttacagagcagctgcaaaatagcacagggcatccctgtagatctttc
acccagatccctcagatgttagcacagatgttaacattttgccctgtttgttccccccag
CTCACTTTCCGAATGTGAATATGGGT
gtgtgtatatgtactgtatatgcattttttgcctgaatcttttgaaagtaaacacttcag
tgtgtttttcctaaaaacaagggcaatatcgcacataatcactattccattttgaaaatc
agcactgacacattcatgatctaatgctcagactcattcagctttccctgtctgttgacg

 1.04 Intr +   3771   3884  114  2  0   60   75   149 0.612  12.61
tccctgccagctggcaggaggaggtggcttgtgtgccttgcaggtgacaatgtgggcagc
tcatgaaggtaggcttgaagccccaggcaagcccagtgacccggtcacagtgaagtgcct
gtgtgtgtaagaaactgacagaacgtgctgtccctgcctcctgctctttcacatgtgtag
ATCGTAGCTGGGGTGAACTACTTCTTGGACGTGGAGCTGGGCCGAACCACGTGTACCAAG
ACCCAGCCCAACTTGGACAACTGCCCCTTCCATGACCAGCCACATCTGAAAAGG
gtatgtgccttatatgggtccagggccagtcatacactgcagaggggtgtgtgtgtgtgt
gtgtgtgtgtgatgcacatgttctgcagggtacgtgtgcatgtgcctgagtgtgtgtaca
cgtggagatgcatatgtgtttccaagtataggtttgtgtggggaagtgcacgtgagtgtg

 1.05 Term +   5139   5222   84  2  0  113   50    21 0.531  -0.63
ggagcagtcactgcccagtccagcggtgctctgggatcagcgggggtgggtggaggggta
gataagggcccagtgtttcacctccatccttcttcactcccactctgatgtcccgtgcct
gggcatcttctgctttgaactgtaacccacactgattgtcccctctgtttcctttcacag
AAAGCATTCTGCTCTTTCCAGATCTACGCTGTGCCTTGGCAGGGCACAATGACCTTGTCG
AAATCCACCTGTCAGGACGCCTAG
gggtctgtaccgggctggcctgtgcctatcacctcttatgcacacctcccaccccctgta
ttcccacccctggactggtggcccctgccttggggaaggtctccccatgtgcctgcacca
ggagacagacagagaaggcagcaggcggcctttgttgctcagcaaggggctctgccctcc

Predicted peptide sequence(s):


>CST3_1|GENSCAN_predicted_peptide_1|209_aa
MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEY
NKASNDMYHSRALQVVRARKQPPPALLPDPVLLLSGAWASHPDPVPGLRCHPRALGGRVR
ECPESGLAWNRTDTSAHFPNVNMGIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHL
KRKAFCSFQIYAVPWQGTMTLSKSTCQDA