GENSCAN 1.0	Date run: 16-Jan-104	Time: 01:48:34

Sequence CDH26_1 : 57085 bp : 42.78% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1507   1569   63  0  0   64  115   189 0.821  18.40
aaaagctgaaaagggaggagcaagatgggatgaaagcatctgggccaaagtgacctgaaa
acctttagagaagaagctgctggctgagaaggaggtgtgtggctccggtgagaccaccag
cttggaggactggtcatcagctgcacgttctgggtctgtcttgggtattcccatatggcc
ATGAGATCCGGGAGGCACCCCTCGCTGCTGCTGCTTCTAGTGCTGCTGCTGTGGCTGCTG
CAG
gtaagctgagcctgcagcctagtgctcaggtgcagggaactgaaagcaaagcacaagctg
gccctgccccttctaggctaagggaggggagagggactgagtgtgacctgctgggaccca
gggctggctgtcttgagaatggcttaggtagcaggggctctggatttatataaagggaag

 1.02 Intr +  11741  11797   57  1  0   91  100    68 0.978   6.46
gagaagataagtggcaatcatgaattaagatgtagaggataagaaattctatttaccaaa
actaactacagaagttctgttttcatcatttctaattctagatttgtgcaactccaggtg
gtttccatgtgattctggtaagaatattctctactaattaatattatttttatttttaag
GTCAGTATCATTGACAGTGTTCAACAGGAAACAGATGATCTTACTAAGCAAACAAAG
gtgaggtttggaagtcagtttcttaatatataaaatcagtctctacacttgacttagaga
cagaattgcagtttggagttctttagtgccctgccaatgtttggtttgcagaaaataaaa
tagtaacttcatgtggccttttagaatcttgagggactgccagagagttgcaggtgatgc

 1.03 Intr +  12838  12960  123  0  0   58   94   159 0.970  13.36
ccccgtggttagagatgactctacagctattaagaagacaggcacttgggttttccaagc
ttaggtggctgttctggcgatgagagaatgcaggccaggtgtcagcacagggcctttaca
tgaagtaagggtgtgataaatcctggctgtgagcatcactgccatcctcattgtcaccag
TGTCACTATAAGTTCCAGGAAAAGATCTACCAGCCTCTACGGCGATCCAAGAGAAGATGG
GTTATCACCACCTTGGAGCTGGAGGAGGAAGACCCGGGACCCTTTCCCAAACTCATTGGT
GAG
gtaaggtgcctactcttaaggaatgaccccatcatgccctctaagtaagcacgccccttt
ggccaggaagattaagtcttgaaaggttatgtgctagtgaggccagggagtgaagtagag
cagaaggagcactggcctggggttcaggaagcctgggttctagaactcactctaactcta

 1.04 Intr +  14736  14897  162  2  0  112   22    90 0.191   4.05
gctaacagttcaacatcattgttcctgcatctcagcccatctgtttatttctttggcaga
tgtgccattgctgggtataatttcttaaagatgccattgattcttagccttgatacttga
ttatcatagtggcttattctcatcctccttttttcttctttccatttttcctccttccag
CTGTTCAATAATATGTCTTATAACATGTCACTAATGTATCTAATCAGTGGACCTGGTGTG
GATGAATATCCAGAGATTGGTTTGTTTTCTCTAGAAGATCATGAGAACGGAAGGATATAT
GTTCACCGCCCTGTCGATCGAGAAATGACACCATCTTTCACG
gtatctaaaacttgatatattctaagctcggatttaaaagctcttgcaagactgttgtat
ttggtaagcattatttaagctgactatgtgccaggttccgggagattgagaaattatgcc
ttgtgacaagctttacgagtatgcctgagacttttgtaatcttcttttagagttgtggac

 1.05 Intr +  19871  19948   78  1  0   45  105    55 0.236   1.73
ctttcaaggcccttagaggccccctgggagggccaccgaccctgggcactgagtagccat
agagtgaagtgaggaagaatcggcggaaggtgcagtcttgatccctgactggacttgaat
ctgggctactctacttccaagctgaaggtgaaatagtcacttagtctctccatggtgcag
AGCTGGACAGCAAGGGTGCCTTCCTCCAGGGCTTCCGCGGGGATGAGCAGAGGCCATCTA
CGGGAAGGGCTGGTGCTG
gtgagtccgccctgggcctggctgaagctggcagccaggcttctgcaataaaccttttta
ccccaagcaggatactgtacctggcgaccagttgacccttgagaatccagtggtctgact
gcagaacaggcctctgcctggaccaccctcgtgccaggatccgtgccctttcccactccc

 1.06 Intr +  25697  25844  148  1  1   70   89   159 0.996  13.09
ccagtactgttcttgctctctggggtacttggtaaatgagggcagtctgattcctgccct
ccggaactctcagtctagaggaggagacagacgtaacacataattaggataacagttatt
ttattagagtgtcatcgagtaaatggttctgcaggatttttacagctctctgcttcctag
GTTTATTTTGATGTTGTGGAGCGCTCAACAGGAAAAATTGTGGATACATCCTTGATTTTC
AACATTAGGATCAGTGATGTGAATGATCATGCACCCCAGTTTCCAGAGAAGGAATTTAAC
ATCACTGTGCAAGAAAACCAATCTGCAG
gtgtgtgcggctggggggctgccgggcttccttctgtctctgctctgttccttttcatta
atattgatgaggagcttgatcctagtcatcttcagggagagtttttactgttcacatctc
aaagatcgcaggccttggatctgagcgaaatgctttgaggtccgtaagcctcattttgta

 1.07 Intr +  27413  27579  167  0  2   69   19   180 0.964   7.96
cttataactaattaaatattcatccttatcttttctagtatgtccatagtttattttata
tttaaacattccactcattttggtatatgccccaatgccatttagcaaataattcatcct
cttactggtttgataggctacctttatctgatagtaacaatttttaaaaattctttctag
GGCAACCTATTTTTCAGATGTTAGCAGTCGATTTGGATGAAGAAAACACTCCAAATTCTC
AAGTCCTTTACTTCCTCATTTCTCAAACACCATTACTGAAAGAAAGTGGTTTCCGGGTTG
ATCGCCTTAGTGGAGAAATACGACTCTCTGGCTGCTTAGATTATGAG
gttatgtggattttattattttttttaaatgaaatgtgtggcccatccttgagccccagg
cttagattctacatttgtagtggggaaccctctgtggctagatttgctattgaaattcct
aaacagaatatttctttattaatattttcctttcctgtatttgaggggcttaactttcct

 1.08 Intr +  27775  27903  129  0  0   97   64   139 0.992  12.37
ttattttttttaaatgaaatgtgtggcccatccttgagccccaggcttagattctacatt
tgtagtggggaaccctctgtggctagatttgctattgaaattcctaaacagaatatttct
ttattaatattttcctttcctgtatttgaggggcttaactttccttttcctcccacatag
ACCGCTCCTCAGTTTACACTGCTAATCAGAGCCAGGGACTGTGGAGAACCGTCACTGTCA
TCCACGACCACCGTTCACGTGGATGTGCAAGAAGGCAACAACCACAGGCCTGCATTTACC
CAGGAGAAC
gtgaggctcctgggccgccccaacgtctaagccccaaaacaagtagcccttgggtcctag
gctcagtttttctcagagagggtgttaggctgttatcatattgctgtgaagaaatacctc
agactgggtaatttataaagaaaagaggtttaattggctcatggttctgcaggctttaca

 1.09 Intr +  30227  30412  186  1  0   51   87    85 0.782   3.66
caaatcccttagggcaggtttagcagcatgaggaatatccagggtgttgtgatgaggagc
aacattctttctccttctctctcttgctctctctctgcttctctccctccttcctctctg
ctttccttttcaattgtgtttttgtttccatgacatggacatgatgattgcttctttcag
TATAAGGTTCAGATTCCTGAAGGCCGAGCCAGCCAGGGCGTGTTGCGTCTCCTGGTTCAA
GATCGAGATTCTCCATTTACATCAGCTTGGAGAGCAAAATTCAACATATTGCATGGCAAT
GAAGAGGGGCATTTTGACATTTCGACTGACCCTGAGACCAACGAAGGGATATTAAATGTT
ATCAAG
gtaacaccataccggtgacataccaaccagttagtggcagacgctgaggcctcttctgta
ggatcactcacaatgaaccagggagctaacgtccgtggatgctgggtgctgagcccatta
cgtaccacacgtcaccaggcaaggaaggcagggtctcagtgccacttctgtgtgtgggct

 1.10 Intr +  31678  31937  260  0  2   57  100   315 0.978  24.94
ctccataaatgatttgaaaatgagctgtagactgtcttttgatcattatcaaagacaacg
taaataataaatgaagtgcaaaagccacaagctctgagtttgcaatgatgactcggcgct
gggcttcctctggccagaggagcagcaggtgctaatgaaatcctctctctggggttccag
CCTTTGGATTATGAGACTCGCCCAGCGCAAAGCCTCATCATTGTCGTGGAGAATGAGGAG
AGGCTCGTCTTCTGTGAGAGAGGAAAGCTTCAGCCGCCAAGGAAGGCAGCAGCCAGCGCC
ACTGTGAGTGTGCAGGTGACAGACGCCAACGACCCACCAGCCTTTCACCCCCAGAGCTTC
ATTGTCAATAAAGAGGAGGGCGCCAGGCCTGGGACCCTGTTGGGAACTTTTAATGCCATG
GATCCAGACAGCCAGATAAG
gtgagaagagagggccaagaagggcggttgtttaagtggaaatagccacataaccaagag
ggctcctgttagaaaaccagctcggccgggcgcggtggctcacgcctgtaatcccagcgc
tttgggaggccgaggcgggtggatcatgaggtcaagagatcgagaccatcctggctaaca

 1.11 Intr +  35152  35294  143  1  2   59  101   179 0.999  15.38
tgtgcttccattcctttcgtgaattaaacactctcgtagtttaattgctcttagaatttc
tcaaattacttgtggtagaaatagtgtttctatgacatattttgtttttttatgcaactt
ttttatcttttaatgtaagtttttaattttaaaaattgctgtccgttttccttctacaag
ATATGAACTGGTTCATGACCCAGCAAATTGGGTCAGCGTCGACAAAAACTCCGGAGTGGT
CATCACCGTGGAGCCAATTGACCGAGAATCCCCTCATGTAAATAACAGTTTTTATGTAAT
CATCATTCACGCTGTTGATGATG
gtgagtgtttacccaaaattggaaaaataaaatgctcattcttgcttcctgcgggaaaat
aaccctggtgagcgtctttcagcacagcagagaaaaggataaaataaaccttgttatcac
tctgcatccatgctggtgattatttttggtaataattcttaaaatggtaaacaagggacc

 1.12 Intr +  37024  37263  240  2  0   42   84   282 0.986  19.80
ctgaatgctcataaaagcaggaaaacagatcacgtgcatgccaggagagcttatgacgtt
gaaagggaaacagttccagtatttcaggaatattttttttctgagagacggagagtgctc
attctccagagctgtgtgtgcacgagataaacaactcctgaaacttcctccccatacaag
GCTTCCCACCGCAGACTGCTACAGGGACCCTAATGCTCTTCCTGTCTGACATCAATGACA
ACGTCCCGACTCTCCGGCCACGTTCCCGCTACATGGAGGTCTGTGAGTCTGCTGTGCATG
AGCCCCTCCACATCGAGGCAGAGGATCCGGACCTGGAGCCGTTCTCTGACCCATTTACAT
TTGAATTGGACAATACCTGGGGAAATGCGGAGGACACATGGAAGTTGGGGAGAAATTGGG

gtgagtttttgtattggttacgggcaaagagtggaaaatgccagatatccaattcaaaca
gatttaggcaaaaaaggactttattagcttaaaaaaccggagaggtctgcgttctggcag
agctggctctaggtgctcaaaggatatccctggatatccttcccacacatggtctgcctt

 1.13 Intr +  37467  37583  117  1  0  106   40    35 0.455   0.02
gcaaagagtggaaaatgccagatatccaattcaaacagatttaggcaaaaaaggacttta
ttagcttaaaaaaccggagaggtctgcgttctggcagagctggctctaggtgctcaaagg
atatccctggatatccttcccacacatggtctgcctttctctaggttccttcttttttag
GAAACTCTCCTCATCAGGGGGTAGGAGGCTGCTGGGAGTCCCTGAGACATATTCTTGCAT
CTGGCAAGAAGGGTGTTTCCAGGGAAGCTCCAGGATTGACGTCACTGTTTGGCCTGG
gtcagctgccctgtcaatcactgtgggtgggacttgggagggcggatgtgctgattggct
ggttcccagcccacacctggaccttgttgggatctgggctcaccctctcctgattcatac
tgagaattcaggaagtgtgggcttccctaaggaaacactggggcactgttaccagaagat

 1.14 Intr +  38607  38828  222  1  0  128   82    75 0.973   8.08
atccgtgaacttgcagttgatgtcagaagtgagggtacccttgaggacccctccctctaa
ctctgcagttggcttactttcatacagagcttggcccgtgcagggcgttcagtaagcgtg
tgttgagcagatgagcagatgagtgagtcaatgcatgccatgttctttttccctttgcag
GTCAATCAGTTGAACTTTTAACCTTGAGAAGCCTGCCACGTGGTAATTACTTGGTGCCAC
TCTTCATTGGAGACAAACAGGGACTTTCCCAGAAGCAAACTGTCCATGTAAGGATCTGCC
CCTGTGCCAGTGGGCTCACATGTGTGGAGCTTGCAGATGCAGAAGTGGGGCTTCATGTGG
GGGCCCTGTTCCCTGTCTGTGCAGCATTTGTGGCTCTGGCAG
gtcagtggtctgtaggggtgtcctgggactgtggctcctctccccaggcaataggccagg
ggtaaggggcttgctggggtaggggacagcggtggcaggattggtggaatggctttgaga
atgacttctgggtgtactcaggctcctagatgtagatcagaggttgccatgctggccagg

 1.15 Intr +  39405  39535  131  1  2   86   72    44 0.976   2.09
tatgtagcatctactggtaccctggaactgtgctgaactttatagctacacagatgacta
agacgcaatttggccttgccagttcatgactgagttatacatgaacagaacaagatcctc
atgaaacctctgatatgggtgagcttgtctaatctgtttttcccctttgtcttataacag
TGGCTCTGCTTTTTCTGTTGCGATGCTATTTTGTGCTTGAACCTAAGAGGCATGGATGCT
CTGTATCCAATGATGAAGGCCACCAAACACTGGTCATGTATAATGCGGAGAGCAAAGGCA
CTTCAGCCCAG
gtagtggaatgtcatgctttgtgtcttatggcaaggaattcactaatacacagacatata
gcatgtatttttccccccattgtgccacctcttaattcttcactcttacccgtgtttcag
tagcaagtgggaaaaaattcttgcaaatactatctaactcagataaatgaatttattctt

 1.16 Intr +  42360  42437   78  2  0  118   87    72 0.820   8.93
tcttttcccacataagtcatccagatttacaggagaggtgtattttttacagtctggact
tcttctgtgatggcatagatacaatgtgttttggagaaaatgtcattcctttccttctgt
ttttatttctgctatctgtgatttcagcccttgtcatatttctttctctgtgttctacag
ACATGGTCAGATGTTGAAGGCCAGAGGCCGGCTCTGCTCATCTGCACAGCTGCAGCAGGA
CCCACGCAGGGAGTTAAG
gtaacatgccccttacttgcttctggatttcagagaagtgactttcctggtggtttccct
gacaaggaacacctgggatgctcctcccagtgccacatccagggaggttcttcttcaagt
cagcaaccccagcccctacttgcaaagccccatggttcccttagcctaaaacacccttgt

 1.17 Intr +  43452  43527   76  2  1   85   86    -9 0.650  -3.23
tcctgggctggcgagagccttctctttccttcctctgagccagtctgcaaacttctagag
gtctaggtgttgccctgaggggcacactatgcactttgcatgcctcatcttattgaattt
tcaccagaacccataggggcgtgtgtgtggtaggggcaatcttgcttccctattttacag
GGGAGGGAACCAAAGCCTCCACCTTCTAGGTTTTGGTGTATCTCTGGGTTCCCTTCAGTG
TCCTGCAAATATTGTA
gtaagtacatctctggtgactgcttaaataaactgccattcacacactttctctaagtga
agccgtcacttatgatttatggggtaacctgatactttaaaatctgctggatagtgtgaa
atagcgtcaatgagaccattgtcaaggtccattgcctgctttattttctttgaaatataa

 1.18 Intr +  44117  44185   69  0  0   66   92    84 0.789   4.84
ttccctgcctctcttcattttccttttcctcccaccgcgccctccctctcatcgtgttaa
tttgtgtttgcctatgaatatatgagcaaggggaagtggtgagaggtcacgcatgcccac
tttgtttccagctggagagaaatccattctcttttgagtaaatcagcattttccctctag
GATCTCGAGGAAGTGCCTCCATCTGCAGCGAGTCAGTCAGCCCAAGCACGCTGTGCTCTG
GGGAGCTGG
gtgagttccagaaggttgctccctgctacggccatctcactagtgactaacagttggtcc
ccctgagagagggccgttgtagaagattcggtgatactgtcagaaaaaggcacatagtca
atgaaaatctgagaagctgggctttttccacccgactctatttccatctatagaactagg

 1.19 Intr +  49044  49125   82  1  1   88   31   115 0.417   3.58
ccactcttgggtgcttgccttgcacctgcgtgagctcgacagtgaggccccaggtgcttt
gcttgcctccaggccagcctgactcacatgatttagtggtgggatttgtgagcccccaga
tagccactccttccagtagatgccaagcctgtttcctaccactgtatcctctgcccttag
ATAGCACAGAGACCCAGATCCACAGACATGGGCCAGATGAGCAGGAGACTGCCAGCAGCC
CATCATGGGAAACAATGGGCAG
gttcagaggaagagaagccaaaatgagcgaggaggggcagtgtagttgagggggtgcaag
gcatgagtgagggtgtcagcaggaacaaccctcctggccgggctcacttgggttccttcc
tcactgaaagtttgtttcagcccaggcattggaaagtctagccatgagagcttgcagggc

 1.20 Intr +  51590  51753  164  2  2   57   81   111 0.492   6.00
actgtggcctgaggaagtgagcccagactgtgtctggatgtagagtcactgtctggggtt
tccccaatgttgcttcctctggttcctgtcacagtccccaggtgggagctccagctctgt
gccccagtgacagccccaaaggtgctgtaggcttggccccttctcactcccactccttag
CCCTGCAGAATGGGTGCTGCCTGGCACCTGCTTCAAGACAACACAGACATCTTCTCCGGG
CCTAGAAGCTTTGCCTAAAAGCAGGCAAGCCAGGCTCCTGCAGAAGGGGGCTGTGTACCC
ACAGACTCAGGGCTGCAGGGCCCTTCCCCAGGTCCTGACTGCTG
gtgaggaagatgaaggatgagctgcggggaaatttccatgtgtctctcccgagccgactg
taacctccctgagggccaggctgtgtcattactggtgcatgacacaggggtcactgaaga
agcaatgaaagaaccattttcactataacccaatgtggtagatgaatccaaaaatggagg

 1.21 Intr +  52346  52434   89  0  2   78   44    52 0.209  -1.43
catcacgtagtatccagcttacccattttcacatttgcgcacacacacgtgaacgcatgc
acatgcacacataccgctcatgccaagtggactgtgtggacagtatcgcaggtcctgcct
ggctgagcaggagagggacgtgttccagccgcgggcccccctcctccctctgcggggcag
GGAGGCAGCTTTATTCAATGGAAGCTCGAAGCTCTGCTTGGTGGTGTGAGAGGAGGGAAC
ACCAGATTAGAGGGCCCTGTTCTTTCCTT
gtgagccctctaacttggatggtggtgtatgatgaattattgatctgatgaggcctccaa
agttgctgaatcagggtgcagacatccactgctctgctgtcagcctgggggttttgaagt
tgaatccacccagcacagcccccactgcagattctgttttgctctgcacacaccaggtct

 1.22 Term +  55301  55504  204  1  0  101   42   126 0.480   5.69
atgtctcccctcagcatggctgccacttctggaactgtacgaactcctgtgtcagctgag
gacacggggcctgagtgctgttactactgcattgatgtgttcctcgaatcaaacctagag
aaatgagctgggtatggaagcacatggcatttaccttctctttcccccacttttccccag
AAACTCCATGTTGCCAATGTGCTGGAAGATGACCCCGGCTACCTACCTCACGTCTACAGC
GAGGAAGGGGAGTGTGGAGGGGCCCCATCCCTCAGCTCTCTGGCCAGCTTGGAACAGGAG
TTGCAACCTGATTTGCTGGACTCTTTGGGTTCAAAAGCGACTCCGTTTGAGGAAATATAT
TCAGAGTCAGGTGTTCCTTCCTAA
aaaaaaaagtctattttggagaattgaaataattcatggaagggaatcactattcaggga
tttttcccctttgctcttcttttccctccttaaaagaaaaattaccttctagtcctagga
tgaggacacactattagtttgaattaaatgctttgatattctcagatcagccatcttgaa

Predicted peptide sequence(s):


>CDH26_1|GENSCAN_predicted_peptide_1|995_aa
MRSGRHPSLLLLLVLLLWLLQVSIIDSVQQETDDLTKQTKCHYKFQEKIYQPLRRSKRRW
VITTLELEEEDPGPFPKLIGELFNNMSYNMSLMYLISGPGVDEYPEIGLFSLEDHENGRI
YVHRPVDREMTPSFTSWTARVPSSRASAGMSRGHLREGLVLVYFDVVERSTGKIVDTSLI
FNIRISDVNDHAPQFPEKEFNITVQENQSAGQPIFQMLAVDLDEENTPNSQVLYFLISQT
PLLKESGFRVDRLSGEIRLSGCLDYETAPQFTLLIRARDCGEPSLSSTTTVHVDVQEGNN
HRPAFTQENYKVQIPEGRASQGVLRLLVQDRDSPFTSAWRAKFNILHGNEEGHFDISTDP
ETNEGILNVIKPLDYETRPAQSLIIVVENEERLVFCERGKLQPPRKAAASATVSVQVTDA
NDPPAFHPQSFIVNKEEGARPGTLLGTFNAMDPDSQIRYELVHDPANWVSVDKNSGVVIT
VEPIDRESPHVNNSFYVIIIHAVDDGFPPQTATGTLMLFLSDINDNVPTLRPRSRYMEVC
ESAVHEPLHIEAEDPDLEPFSDPFTFELDNTWGNAEDTWKLGRNWGNSPHQGVGGCWESL
RHILASGKKGVSREAPGLTSLFGLGQSVELLTLRSLPRGNYLVPLFIGDKQGLSQKQTVH
VRICPCASGLTCVELADAEVGLHVGALFPVCAAFVALAVALLFLLRCYFVLEPKRHGCSV
SNDEGHQTLVMYNAESKGTSAQTWSDVEGQRPALLICTAAAGPTQGVKGREPKPPPSRFW
CISGFPSVSCKYCRSRGSASICSESVSPSTLCSGELDSTETQIHRHGPDEQETASSPSWE
TMGSPAEWVLPGTCFKTTQTSSPGLEALPKSRQARLLQKGAVYPQTQGCRALPQVLTAGR
QLYSMEARSSAWWCERREHQIRGPCSFLKLHVANVLEDDPGYLPHVYSEEGECGGAPSLS
SLASLEQELQPDLLDSLGSKATPFEEIYSESGVPS