GENSCAN 1.0	Date run: 16-Jan-104	Time: 02:05:45

Sequence BMP2_1 : 12962 bp : 44.50% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   2768   3113  346  1  1   92  100   425 0.936  39.48
cattatcccaaacgtttgagcttcggtcggtcttacctagactcgtgagtgtgccaagcc
aggagggcatcctggaggaggcacgccagccaaatgggagaccgggccgcgggggcgcga
ggggggaggactgggcggggaactcgggtgactcacgtcggtcctgtccgcaggtcgacc
ATGGTGGCCGGGACCCGCTGTCTTCTAGCGTTGCTGCTTCCCCAGGTCCTCCTGGGCGGC
GCGGCTGGCCTCGTTCCGGAGCTGGGCCGCAGGAAGTTCGCGGCGGCGTCGTCGGGCCGC
CCCTCATCCCAGCCCTCTGACGAGGTCCTGAGCGAGTTCGAGTTGCGGCTGCTCAGCATG
TTCGGCCTGAAACAGAGACCCACCCCCAGCAGGGACGCCGTGGTGCCCCCCTACATGCTA
GACCTGTATCGCAGGCACTCAGGTCAGCCGGGCTCACCCGCCCCAGACCACCGGTTGGAG
AGGGCAGCCAGCCGAGCCAACACTGTGCGCAGCTTCCACCATGAAG
gtgaggcatggagcagggcgtgggggcggggagtcaccctgcaaagccctccaccgtggg
cagactgcagccgtccctgtagaggcagcttggccggggcaccagcggacgtttccactc
ttgcttctgtactatcgtttctgaatctgattttaactcactgcttgtgtggtgggggag

 1.02 Term +  10886  11730  845  0  2   58   38   387 0.949  23.77
gggaggctccatgtttatttaaagaggaaatttttattttctggttacctacttttacat
gggttacatcaaatcccacgatgaggtttaaaaattctcatagataatcaaacgtcatta
cttggcttactgaaattcagacttttcttttttcttccctgtttttctctatcaaattag
AATCTTTGGAAGAACTACCAGAAACGAGTGGGAAAACAACCCGGAGATTCTTCTTTAATT
TAAGTTCTATCCCCACGGAGGAGTTTATCACCTCAGCAGAGCTTCAGGTTTTCCGAGAAC
AGATGCAAGATGCTTTAGGAAACAATAGCAGTTTCCATCACCGAATTAATATTTATGAAA
TCATAAAACCTGCAACAGCCAACTCGAAATTCCCCGTGACCAGACTTTTGGACACCAGGT
TGGTGAATCAGAATGCAAGCAGGTGGGAAAGTTTTGATGTCACCCCCGCTGTGATGCGGT
GGACTGCACAGGGACACGCCAACCATGGATTCGTGGTGGAAGTGGCCCACTTGGAGGAGA
AACAAGGTGTCTCCAAGAGACATGTTAGGATAAGCAGGTCTTTGCACCAAGATGAACACA
GCTGGTCACAGATAAGGCCATTGCTAGTAACTTTTGGCCATGATGGAAAAGGGCATCCTC
TCCACAAAAGAGAAAAACGTCAAGCCAAACACAAACAGCGGAAACGCCTTAAGTCCAGCT
GTAAGAGACACCCTTTGTACGTGGACTTCAGTGACGTGGGGTGGAATGACTGGATTGTGG
CTCCCCCGGGGTATCACGCCTTTTACTGCCACGGAGAATGCCCTTTTCCTCTGGCTGATC
ATCTGAACTCCACTAATCATGCCATTGTTCAGACGTTGGTCAACTCTGTTAACTCTAAGA
TTCCTAAGGCATGCTGTGTCCCGACAGAACTCAGTGCTATCTCGATGCTGTACCTTGACG
AGAATGAAAAGGTTGTATTAAAGAACTATCAGGACATGGTTGTGGAGGGTTGTGGGTGTC
GCTAG
tacagcaaaattaaatacataaatatatatatatatatatattttagaaaaaagaaaaaa
acaaacaaacaaaaaaaccccaccccagttgacactttaatatttcccaatgaagacttt
atttatggaatggaatggaaaaaaaaacagctattttgaaaatatatttatatctacgaa

Predicted peptide sequence(s):


>BMP2_1|GENSCAN_predicted_peptide_1|396_aa
MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSM
FGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEE
LPETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPA
TANSKFPVTRLLDTRLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVS
KRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHP
LYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKAC
CVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR