GENSCAN 1.0	Date run: 16-Jan-104	Time: 00:17:09

Sequence XPO1_1 : 62058 bp : 41.05% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.03 Term -    699     68  632  1  2  114   32   346 0.931  25.09
 1.02 Intr -   1922   1666  257  1  2   37   16   205 0.822   4.36
 1.01 Init -  10403  10375   29  2  2   74   77    -5 0.039  -4.43
 1.00 Prom -  11135  11096   40                              -6.45

 2.01 Init +  12279  12374   96  2  0   59   80    95 0.259   6.16
atttatataattttatttctatttctgtaaggtctaatttttgagtatttctgaacatca
ataatagaatctctgtccaattagaatttgtgccttgctcagtagttttcattttaatga
atgattcaaaagaatacattagcttaagttttgttttttttaataatattttagcaaaga
ATGGCTCAAGAAGTACTGACACATTTAAAGGAGCATCCTGATGCTTGGACAAGAGTCGAC
ACAATTTTGGAATTTTCTCAGAATATGAATACGAAA
gtaagcaagtggtggttttaaaatctgttatttcttttcttccagtcataaactttgagg
aaggtatctcatttttagtattagcatttgttatctcaaattattttatattgttaattt
gtttcaaaatttagtcttaagcatataattaattcttgcaaatagtcctaagaattatga

 2.02 Intr +  16111  16183   73  0  1   70   97    36 0.258   0.76
tgcatgaaaactcagtatatgggtgaatagatacttgtttaatatgtgtaattaaacttg
gtagcataatgtttttgaaactttagatgtaaatgtgtgaatgtctgtccatttgtgaat
cctgagagttgccagtcctataagcaatatattcacatgcttctattctccaattttcag
TACTATGGACTACAAATTTTGGAAAATGTGATAAAAACAAGGTGGAAGATTCTTCCAAGG
AACCAGTGCGAAG
gtaggaaaataaagaattataaattcagagttttgtttttcctggcatttttattgtagt
tgactgtttgagggggcatgtaatgaatctttagtatattttgctctaatggagcttatt
gcttttatcatgaagcaaacaggtctgtttgtattggtgggtacaggaaggccacttaca

 2.03 Intr +  36484  36545   62  2  2   67   94    34 0.591  -0.57
agcgtgagccaccgcaccgggccggaatttttttaaaatgccaatactggtgacaggatt
agagtatattaactgattttacttagtctttccattcccacattaattagttctcaaaat
ttatttgcatgctacaaaagagctcaacaatttttttattacgtgcaatttttttaatag
GAATAAAAAAATACGTTGTTGGCCTCATTATCAAGACGTCATCTGACCCAACTTGTGTAG
AG
gtaagagtttattttggagcttattgggagagcataaaatcatttagatattgagtctga
ctacaacctaattctgtcaagacacatagtcacacatatgcacagtcagtcatttacagt
agagctgtaatcatttgttaggattgtctggttatattcttatttatacttacctcaggc

 2.04 Intr +  36754  36798   45  0  0  109  115    46 0.985   7.09
agagcataaaatcatttagatattgagtctgactacaacctaattctgtcaagacacata
gtcacacatatgcacagtcagtcatttacagtagagctgtaatcatttgttaggattgtc
tggttatattcttatttatacttacctcaggctctcatttaatcttttacttttccttag
AAAGAAAAGGTGTATATCGGAAAATTAAATATGATCCTTGTTCAG
gtaagctttaacttaactgttttccttagaagaattatgcttattatttgaacaaaatgt
tcgacctacttaggaaataaagtatactaatattttgcagaagtagtgatagtattctta
taataataggtaacctactgtctagtacttgaatgttaatttgctgtggcagtaatcatc

 2.05 Intr +  38900  39085  186  1  0   74   29    88 0.554   0.46
gttttgttttctacccagtagggtgaagagggtggcacatttcttcctttaataaaggag
gagaaaatgaaaagtgatttatccttactcctgcctttatccattacataatttctttga
agtttgttttatttgcctttgagaaatgaagtgcgattaacatttcatgtcttgttttag
ATACTGAAACAAGAATGGCCCAAACATTGGCCAACTTTTATCAGTGATATTGTTGGAGCA
AGTAGGACCAGCGAAAGTCTCTGTCAAAATAATATGGTGATTCTTAAACTCTTGAGTGAA
GAAGTATTTGATTTCTCTAGTGGACAGATAACCCAAGTCAAATCTAAGCATTTAAAAGAC
AGGCAA
gtaataattatgttttagaattttaaagtgatttctcaaacaatttcaagcagtttggat
gtaaattgtagatattttaaggaactatgatcagtaatatgttaaattgcttgtagtggt
tttcaactgcagattaagaaatagtcctagacggggcctaataatttacctctgaaggtt

 2.06 Intr +  41787  41915  129  2  0   55   90   118 0.985   8.67
taggcaataaaattccctctcagtatatctgcatgataaaatatgttcattcacttggcc
tgtttttgacatctacccctatatttaattgttaaagcctttttccttttaattgtgaat
tttaagtaaagtgtgtatcaggccaattaattttatggttccctccccccttttaaatag
TTCCTGAATGTTCCAATGTTTCGAAATGTCTCTCTGAAGTGCCTCACTGAGATTGCTGGT
GTGAGTGTAAGCCAATATGAAGAACAATTTGTAACACTATTTACTCTGACAATGATGCAA
CTAAAGCAG
gtaatataatactatcttgaaaattggctgaataattttagtgccttagaaaataccaaa
ttccaaatgagttattttagaacgacgtatcaaagataagccataatcttttgtttatta
cataaaatttgtagtaagctacaaatttttatgatgtttccaaaaatttcttaaaattca

 2.07 Intr +  43181  43339  159  1  0   85   94    74 0.988   6.96
ggaggggctgaggaggactgattgggcctaggaggtggaggctgcagtgagctttggtca
taccactgcactccagcctggacagagtgataccttgtctcaaaaaaataataataaaat
attaagtgtctttagttgttttataaaatgcgaactgatcgtcccttttaaaatttgcag
ATGCTTCCTTTAAATACCAATATTCGACTTGCGTACTCAAATGGAAAAGATGATGAACAG
AACTTCATTCAAAATCTCAGTTTGTTTCTCTGCACCTTTCTTAAGGAACATGATCAACTT
ATAGAAAAAAGATTAAATCTCAGGGAAACTCTTATGGAG
gtaagatatgtggagcttttgctcctaaaattctgctctgcctactaataactcttaaaa
gtgcctttttctaaaatgtatgtaccttttgagatttcttattacttaatatttgatcag
tacattatatatattctcaattctgaattacagttataagcccagttttctgattttatg

 2.08 Intr +  45741  45879  139  2  1    2  106    97 0.960   2.02
cctggccacaacagttctttttgcctcggccctccggaatagttggaattataggcatga
atccctacacatggctggcttgtggtttttttggttttgtttgtttttaactaagcttct
acactaatgatttcagtgatctaacgatttttttcttgattgatatattgttgagtatag
GTCCGTTTATTAATGGTTAGTCGAATGGCTAAACCAGAGGAAGTATTGGTTGTAGAGAAT
GATCAAGGAGAAGTTGTGAGAGAATTCATGAAGGATACAGATTCCATAAATTTGTATAAG
AATATGAGGGAAACATTGG
gtaagttaataaatactgttaatctttacctttataaatctattctggggtggaaataca
ttttaggaaatgtacttgtagtttctaaatattttctaaatgtattgttactcatcaata
aaattctgctcattatttgcatttgaaaccatgtttttctttgtagtttatcttactcat

 2.09 Intr +  46046  46227  182  0  2   67   91    94 0.873   6.27
gagggaaacattgggtaagttaataaatactgttaatctttacctttataaatctattct
ggggtggaaatacattttaggaaatgtacttgtagtttctaaatattttctaaatgtatt
gttactcatcaataaaattctgctcattatttgcatttgaaaccatgtttttctttgtag
TTTATCTTACTCATCTGGATTATGTAGATACAGAAAGAATAATGACAGAGAAGCTTCACA
ATCAAGTGAATGGTACAGAGTGGTCATGGAAAAATTTGAATACATTGTGTTGGGCAATAG
GCTCCATTAGTGGAGCAATGCATGAAGAGGACGAAAAACGATTTCTTGTTACTGTTATAA
AG
gtatgcaagggataggtatgaattagaattgctaaataagtattatgttgttacaataaa
taatacaaatttgtcttatttacaggatctattaggattatgtgaacagaaaagaggcaa
agataataaagctattattgcatcaaatatcatgtacatagtaggtcaatacccacgttt

 2.10 Intr +  46598  46759  162  1  0    9   91   124 0.735   4.05
cactggaaatttctgaagactgtagttaacaagctgttcgaattcatgcatggtaaatct
ctttctttactatattttgcttttatttttattgaagaaaataaatgaatgtttttgtct
tgttagagacccatgatggagtccaggacaaaataaatgaatatttttgtcttgttagag
ACCCATGATGGAGTCCAGGATATGGCTTGTGATACTTTCATTAAAATAGCCCAAAAATGC
CGCAGGCATTTCGTTCAGGTTCAGGTTGGAGAAGTGATGCCATTTATTGATGAAATTTTG
AACAACATTAACACTATTATTTGTGATCTTCAGCCTCAACAG
gtatgttaagcactgagcatatgttatttttagaaagtaacacttgtatcaatctgtatg
tatcaatggaaataggagggcaactattggatccaatagaagtgtttctgattaaatttt
ctttcttttttccttgagacagggtcttactctgttgcccaggcttgagtgcagtggcac

 2.11 Intr +  48018  48152  135  2  0   66  106   102 0.999   9.64
tctgcaactcctgaccacaagtgattggcctgccttggcttctcaaagtattgggattac
aggagtgatccactgcacctgggccaaaatcagtttcaagacgtttgtgaattgcttgtg
tgtggttttccttattagggtgtataacataaacgttaaaatgtctgctttttaaaatag
GTTCATACGTTTTATGAAGCTGTGGGGTACATGATTGGTGCACAAACAGATCAAACAGTA
CAAGAACACTTGATAGAAAAGTACATGTTACTCCCTAATCAAGTGTGGGATAGTATAATC
CAGCAGGCAACCAAA
gtaagtatttctaccttttcttaaaagttttcatgggatttaacaagacgtgttctttac
aaatgtattgaattcaagccttttaacatgtatgtgtgatccataagtgcttttatgtgt
gtctttctataatttattatctgggcgaggtgtggtggctcacgcctgtaatcctggcac

 2.12 Intr +  50023  50206  184  0  1   61   78   143 0.999   9.04
ttttttgtatttttagtagagacggggtttcaccgtgttatccaggatggtcccgatctc
ctgaactcatcatccgcccgcctcggcctctcagagtgctgggattacaggcgtgagcca
ctgttcccagccgtggataattcttatatgataaatggaatttgctttttttcctccaag
AATGTGGATATACTGAAAGATCCTGAAACAGTCAAGCAGCTTGGTAGCATTTTGAAAACA
AATGTGAGAGCCTGCAAAGCTGTTGGACACCCCTTTGTAATTCAGCTTGGAAGAATTTAT
TTAGATATGCTTAATGTATACAAGTGCCTCAGTGAAAATATTTCTGCAGCTATCCAAGCT
AATG
gtaggtgattctgatttcttacacaatgcagtataaacaaaccacttctcttctactgcc
ttaagtcaaacatttgatgttttttacagatttaaatcagacctcccatttcccaaatga
ccctagacatatttaaaacagttaagtgtacctttcccttttaaaattagtcttaaagct

 2.13 Intr +  50523  50629  107  1  2   72  115    27 0.979   2.81
aacagttaagtgtacctttcccttttaaaattagtcttaaagcttattttcccaataaat
tttgtgaacttttggctttaaactttttaatggtaaaatggaattgcatctaatgtacac
ctgagtaccactgtataagtttagtggtaaaattagattccatttgattctgttttgtag
GTGAAATGGTTACAAAGCAACCATTGATTAGAAGTATGCGAACTGTAAAAAGGGAAACTT
TAAAGTTAATATCTGGTTGGGTGAGCCGATCCAATGATCCACAGATG
gtaagtgagagatgctttgcttttgatttctagtgttgatgctgtgttttatggaatatg
ctatactctattatgtgcattttgctaatttaaagcatatcaactttgtggttattttat
ggcattttatttattgtagtccttacgttaatatactaatagctgtattccatcttcaaa

 2.14 Intr +  52832  53026  195  1  0  119   93    90 0.993  11.29
gatttcctgctttcttttgctaaaaactgttttgacgtaggaaaccctaatacaaacaca
agattttcctgttttcagtagatgatcatgctacatctcatagacaggaataaccttgtt
gtttaaaatagtcaccatgtacctaaattaaaacataacttttttttccctccccaacag
GTCGCTGAAAATTTTGTTCCCCCTCTGTTGGATGCAGTTCTCATTGATTATCAGAGAAAT
GTCCCAGCTGCTAGAGAACCAGAAGTGCTTAGTACTATGGCCATAATTGTCAACAAGTTA
GGGGGACATATAACAGCTGAAATACCTCAAATATTTGATGCTGTTTTTGAATGCACATTG
AATATGATAAATAAG
gtgtgtaatatttcagttatgtaagggggaaattctgcaggatagccttaattcttgaaa
gctaaagtatgtctgtggatataacataattttaatgccatggagtttaaatatttaaac
ttgtatattagggaaatactttcttggttttcaagaacttacttcccaggagtttgaaac

 2.15 Intr +  54689  54857  169  1  1   68   66    88 0.788   3.20
ttcattttccgtgagaggtggattgtattttacttgggtttacctttcaggaggcattct
atcttctgtggtttattgaaaactccaaatatttatactggattaagccttgcttttccc
ctcctgtctagcacaacaaagacactgaaacattattttgtttccaccacttatttttag
GACTTTGAAGAATATCCTGAACATAGAACGAACTTTTTCTTACTACTTCAGGCTGTCAAT
TCTCATTGTTTCCCAGCATTCCTTGCTATTCCACCTACACAGTTTAAACTTGTTTTGGAT
TCCATCATTTGGGCTTTCAAACATACTATGAGGAATGTCGCAGATACGG
gtaaataaaagatgttcttttattcatttgcctgccaatccaaaaatacaaatatagtta
attgtacataggaaggtattacttgttcagagttttgagtgtgtgaattacatatatgaa
catctgagaaaatcctataagcagtttaatcaactgttccactccactccaagtgagtcc

 2.16 Intr +  55703  55837  135  0  0   89   99    26 0.694   3.42
gcattggatatagttgtattccattattaatttaagaaaccttatgcaagtaattattag
tcatcatcccaaaaaaaagggagaacagggttagattcagaatactttgataagagctaa
atactatcatgagtgctgtcagtctgtagtaactttccattggtattctatgtcttttag
GCTTACAGATACTTTTTACACTCTTACAAAATGTTGCACAAGAAGAAGCTGCAGCTCAGA
GTTTTTATCAAACTTATTTTTGTGATATTCTCCAGCATATCTTTTCTGTTGTGACAGACA
CTTCACATACTGCTG
gtaagaatttaatacgatttaaatgttaagtgccagctgggcacagggcctcacgcctat
aatcccagcactttgggaggtcgaggcggggagattatgaggtcaggagttcgagaacag
cctggccaccatggtgaaactgtctgtactaaaaataccataaaaaaataaaagatacaa

 2.17 Intr +  57856  57884   29  2  2   83   86   -15 0.300  -5.28
gaatttttatcacttgatttgtcatgccaaataaatggggtttcaagataatacgtttac
acaatctctgtaatcaaaaaacctgagactggtaatacagtgaaaaactaaagtccaata
aggatagatatgtttgagatgttattcggataaacttattactaatgtaattcattttag
GTAGTCTTAAATGTATAATGGAATATTGG
gtaagaaaaacgttggtagttctttttataattttataccaattttgttagttgagggaa
cttgtgaaagttactagatagaatgtctttcttctgctgttatacagtgctttattcata
cttttgggaagggtttttctttgaacatcttgctttaaagaaatttggaagtactgtgaa

 2.18 Term +  59828  59974  147  1  0   93   38   161 0.929   8.52
aggtttgcagttcattcagctatgtagtatactgtgtcactatcctataatttaaaaccc
agccactttatggataatttatattccttccttctctaaaaaggaaattgctcatctatg
atttctttctttgcaagttgaagtttattgcgttgacatttcaactatctgttttcacag
GAATTTGCAGGTGAAGACACTTCTGATTTGTTTTTGGAAGAGAGAGAAATAGCCCTACGG
CAGGCTGATGAAGAGAAACATAAACGTCAAATGTCTGTCCCTGGCATCTTTAATCCACAT
GAGATTCCAGAAGAAATGTGTGATTAA
aatccaaattcatgctgttttttttctctgcaactcgttagcagaggaaaacagcatgtg
ggtatttgtcgaccaaaatgatgccaatttgtaaattaaaatgtcacctagtggcccttt
ttcttatgtgtttttttgtataagaaattttctgtgaaatatccttccattgtttaagct

Predicted peptide sequence(s):


>XPO1_1|GENSCAN_predicted_peptide_1|305_aa
MGGRGEQITRHRNEGESGHPPLYKANSKWFNQLITFKPLKRNYKTESHVQAPEKLIFPTS
HATLQNRRAFEFPCWRNRESAAPPSPIPSSPPRGPPTGGSPLPLWVVARTAAAKTGTGTA
AGAVATVALADAVAPAAPAAAAAAASPPPPSASNSEPVETGSDWEIPSRLSFQPMAPRSV
WNLGLRPQPALLLVSSSYSRAMSLSLIGPSASQSRLTAPHEPAASAPTSFQQRFARRVGE
GKWGGSKGKRRGVEEEEVGRRAGMSRKESEGKPRGGFVRTSCQSRAARPRALDFPSPCGP
LPPGA

>XPO1_1|GENSCAN_predicted_peptide_2|777_aa
MAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKK
YVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLC
QNNMVILKLLSEEVFDFSSGQITQVKSKHLKDRQFLNVPMFRNVSLKCLTEIAGVSVSQY
EEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEK
RLNLRETLMEVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLT
HLDYVDTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKTHD
GVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVG
YMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRA
CKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKL
ISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAE
IPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSI
IWAFKHTMRNVADTGLQILFTLLQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAG
SLKCIMEYWEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD