GENSCAN 1.0	Date run: 15-Jan-104	Time: 21:32:53

Sequence TANK_1 : 101616 bp : 35.80% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   4035   4140  106  0  1    5   91    94 0.021   0.70
aaataataaattggtagttcaaaataaaccaaccaaacctacacgtttcctctttttctc
tccaatccacatgcttagacacctcttctctattattttggcttcataattctgttccca
actcaaactaacagaaaaagaatgaaaacaatgtgacataagccaagtaaccctatccag
GCATAGCAGCCAAATAAACAAAGCAGCTATTCCTACGCTTTGTGCAAAAAGCCTTCTTCC
TATTATGACAGTGCTAGCTGCAGACCGCAATTTAGTTACAACTGTG
gtaagcaaaatgtgtgtccaaattgattaatcttatatccaacttatattaagaaaatgt
atgctaaagagaaatgtttgaaatttgctaagaatttttaatattcatattcaaaactag
aaggttagtatttttgtttttatattcataagtctgtaaaaattagtctatatttttatt

 1.02 Intr +  25531  25658  128  0  2   74   54   119 0.001   5.66
gtagagtcctcacgccggtgtaaactgactagcaacgagttacaggcaaaaaagctgtgc
ttttctagaagtagaaagggggaggataatcaaagaagagctgtgcctttattgttatgc
tataacgagcaaaagtaaagcagccttgctatgtaaagtggtgtttatctcacctcacag
GAGATGCTTTTGACAAGTTATAATAAGGGAGAGATGGTAGTAAAGGAAGTGAAGAAGCGA
CGTGAAATTGAAGGAAAAGAAAATGACCTGCCTTCTTACCGCGGTTGGAATACACACCCA
AACGAGAG
gtagcagagaagcaagcagtgcattctgttaaaaattattgtgtcctcatttgagagagg
agggatcctcaaataatacaactatgtgcaaagcaggaagtgaaatccttctcagtcctc
tccccagttgtaatccaagccttccacatctttcctgtatgtgcataaccatgttatttt

 1.03 Intr +  43860  44007  148  0  1   84   93   176 0.609  17.02
aaattgtggaacttaaggtttcatacaatttctagtcaggattttagatgagacttatgt
ttatagtacttggtggtataatgtttgtggtaaaccttatagaactatctttaagatgca
tttttaaaatgaggtttatgtaacttagtaattatctaaattgatctcattattttgcag
ACCTGTCATTTACTCCATCCTTTATAGTGATGCTACAGGACGAAGAGGAATGGATAAAAA
CATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGA
TTCTGCAGTAAAAGAATTACAGCAAAAG
gtgtgtggttctggttttgaaagttattctttatcttggtacatggaattttagagcctt
ttgcatctgaaaaatgttatattgttagaaattgccctgaagaactataattacagaaat
gcaggtatatattaatggattaaatttgaagtttttgtttgttgttttttttaaaaatat

 1.04 Intr +  67733  67841  109  1  1   31   95   140 0.102   7.94
aatcactgatgtttgtaacaattacaagtacattcctggagccagtttgtatctcataaa
tcacaatacctgcaaaatgacaatgtgggcaactcatatctatttatattatcaatggat
ggtaaatatatgttcatgtctatcagtgaatatcaggctaactggtttttatgtcagcag
ACTGAGAACTATGAGCAGAGAATACGTGAACAACAGGAACAGCTGTCACTTCAACAGACT
ATTATTGACAAGCTAAAATCTCAGTTACTTCTTGTGAATTCCACTCAAG
gtatgttcatgttaattttttatgtatttctagaacctcttggtgaaaagaaaggtgtaa
gttgagtttttctattttattccttcgttgtttctcaatagttttgatattataactgtg
gtacagttatatgttatgtttatttaaatgaacacttgcaggatatgggaaagtggactt

 1.05 Intr +  68921  69039  119  0  2   86   69    70 0.364   4.16
ggaaggaaaaaatataaatggacaacttgtcaaagtaactattacctaaagaattttcta
aaactcctaccttaaaatgtattctctttatggttttgagtttgtattattttttgcttt
ttcaggtggtaccaaaaataagggttttctgctaatgtccaagaggtttttgtcttgcag
ATAACAATTATGGCTGTGTTCCTCTGCTTGAAGACAGTGAAACAAGAAAGAATAATTTGA
CTCTTGATCAGCCACAAGATAAAGTGATTTCAGGAATAGCAAGAGAAAAACTACCAAAG
gtagacattgcttctgcagaaagcagcatttaaatgctgatgcgtgacatagcttcctca
ttttatttttctgaagtgatctgctggaattccaaacagaagttccatatatacaaatat
gtggcttaaatatttctaaatagaagaactattttcaagtaaaataaaggctgaggtttt

 1.06 Intr +  83970  84025   56  2  2   89   95   -21 0.054  -4.44
gtaagttcttttagattaaatacaatattctatttttttatcttttatcctcaaactttt
atgtactattcttttatgtttattcttatcaaatatctttttgtaattttttttttggtc
ctgttttataccttaatctttttctgtctcagcccttttttcactttctccctgattcag
CTGTATCCAGTGCTTGACTTCACTATAACATCTTTTGTCTCAGTATATGTAGACTG
gtaaggaaatattcaacctcagttcctcctttaacatttcattcttagttctcaaaaatc
taagtgacaaatgaatctttattttcagtttttttcctactacttacttttcctttttct
gtagtgaattttatcaagctaacatttatacctattccatagtttatattccctctacca

 1.07 Intr +  88877  88992  116  2  2   82   99    50 0.542   4.67
tgcctggccctctacaaacacaagctgattttggggacattgtttaggaatttaaaataa
tttttttttacttttaaataattattttgtggcacataaaatggtactacataagtttga
ttatttaaaaaacttggaagttatagctttacattttaaaatgttgatttttttttttag
GGGTAATATAGAGAAGACTTTCTGGGATCTGAAAGAAGAATTTCATAAAATATGCATGCT
AGCAAAAGCACAGAAAGACCACTTAAGCAAACTTAATATACCAGACACTGCAACTG
gtaagatttaatttaatttacagtaatattgatttgcttgattgaaattgatttcctttt
gaatgtgaaaatattcctgaatgcctattaagtgtgtagcatctgtaatttacccctcat
ccacgtatgtttgaatgtgtacatgctgtgtaagttctgtaatgtattacatgtgtaatt

 1.08 Intr +  95217  95797  581  1  2  128   93   363 0.974  32.29
cacccgctggagactgctaatattctgtgtaagatggtagcaaattttaaaatcccagtt
gtcttcatttgctataaaaaccaatagaaaaaataataataatctctccaaagctgattg
aacagatttttttaatgatttgaatgcggctgtttctcttttgtgttcttctccctccag
AAACACAGTGCTCTGTGCCTATACAGTGTACGGATAAAACAGATAAACAAGAAGCGCTGT
TTAAGCCTCAGGCTAAAGATGATATAAATAGAGGTGCACCATCCATCACATCTGTCACAC
CAAGAGGACTGTGCAGAGATGAGGAAGACACCTCTTTTGAATCACTTTCTAAATTCAATG
TCAAGTTTCCACCTATGGACAATGACTCAACTTTCTTACATAGCACTCCAGAGAGACCCG
GCATCCTTAGTCCTGCCACGTCTGAGGCAGTGTGCCAAGAGAAATTTAATATGGAGTTCA
GAGACAACCCAGGGAACTTTGTTAAAACAGAAGAAACTTTATTTGAAATTCAGGGAATTG
ACCCCATAGCTTCAGCTATACAAAACCTTAAAACAACTGACAAAACAAAGCCCTCAAATC
TCGTAAACACTTGTATCAGGACAACTCTGGATAGAGCTGCGTGTTTGCCACCTGGAGACC
ATAATGCATTATATGTAAATAGCTTCCCACTTCTGGACCCATCTGATGCACCTTTTCCCT
CACTCGATTCCCCGGGAAAAGCAATCCGAGGACCACAGCAG
gtaactgttttgcattaacaaatatattattatgtgtgaacacacattttgccatacatg
cacagatatgcatctcttttacgttatcaaacatcctttttaaactactgacagccaaag
ttaaggctttcaaaaaaacaagtcccataataaatgacatgaaattagaaaagctgaata

 1.09 Term +  99588  99764  177  2  0   90   47   146 0.984   7.40
ccctttatgaaaccacgaattgagtcatgtcatgctaactttacggaaaagtaatttgct
tttatattagggaattcaatatatatgcccatgcgtaactcattcagaaattcaaatttg
aagtccagtgctatttgaatttaaacataagtaacagatatttttgtttgtttcctgcag
CCCATTTGGAAGCCCTTTCCTAATCAAGACAGTGACTCGGTGGTACTAAGTGGCACAGAC
TCAGAACTGCATATACCTCGAGTATGTGAATTCTGTCAAGCAGTTTTCCCACCATCCATT
ACATCCAGGGGGGATTTCCTTCGGCATCTTAATTCACACTTCAATGGAGAGACTTAA
gacacatttgaaaacagacatatcaagttctatgtgatgattttgggtttttaatactat
aaatacttgattgtaaactaaattcaagatcatttataggaaaatctagtttcacagcta
tttgaatttttttctggatttactatataactcttattttttaaaagatcattctgttct

Predicted peptide sequence(s):


>TANK_1|GENSCAN_predicted_peptide_1|513_aa
XHSSQINKAAIPTLCAKSLLPIMTVLAADRNLVTTVEMLLTSYNKGEMVVKEVKKRREIE
GKENDLPSYRGWNTHPNERPVIYSILYSDATGRRGMDKNIGEQLNKAYEAFRQACMDRDS
AVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETR
KNNLTLDQPQDKVISGIAREKLPKLYPVLDFTITSFVSVYVDWGNIEKTFWDLKEEFHKI
CMLAKAQKDHLSKLNIPDTATETQCSVPIQCTDKTDKQEALFKPQAKDDINRGAPSITSV
TPRGLCRDEEDTSFESLSKFNVKFPPMDNDSTFLHSTPERPGILSPATSEAVCQEKFNME
FRDNPGNFVKTEETLFEIQGIDPIASAIQNLKTTDKTKPSNLVNTCIRTTLDRAACLPPG
DHNALYVNSFPLLDPSDAPFPSLDSPGKAIRGPQQPIWKPFPNQDSDSVVLSGTDSELHI
PRVCEFCQAVFPPSITSRGDFLRHLNSHFNGET