GENSCAN 1.0	Date run: 15-Jan-104	Time: 23:35:08

Sequence SLC30A3_1 : 10906 bp : 56.26% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1374   1468   95  2  2  105   75    52 0.265   5.43
ggcggcagcgggatctgcagttcggactccgcgcgccacagtcgctgcagttcgctccac
tctggtggccccgccgccctgcggggatcccgggggtcggcgggctgctcggacttggcg
cggggccggcccggcctctctcttcctcggtggggcctagacggtcggggcaccgggaac
ATGGAGCCCTCTCCAGCCGCTGGGGGCTTGGAGACCACTCGCCTGGTGAGCCCCCGGGAC
CGCGGTGGCGCCGGAGGCAGCCTGCGTTTGAAGAG
gtaggacagacctgggctggccctcggcccgggggcgccaccctactaccctccgtccat
ttcgttgtctctctcggcgcgggccccggcggccgccccagcgcaccgcgggtccctcgc
tccgctgcaccccgcttcatcccctctggccacacggagcgcccagccctacacagccgg

 1.02 Intr +   1914   2029  116  0  2   74   80    64 0.736   4.79
tccgccacccccgcggcgcctgccttccctgggagcagctgccgctcggtcgggccggag
ccctcgcccggtgcgccaaggtccgcattgccccgggcccagggcgggagcgcctcgctg
cccaggcttcagagctccctctgtaggccccgggggctcccctccgcgcgccccctccag
CCGCGGCCAGCTGTGGGCGCCGGGGCCCGAGGATGGGCCGGGCTCCGCGCGGGTCTTGCG
GGCCCCTGGGGGGCGGGCGGCCGCCGGGAAGCGAGGGGGCGGCGAGGAAGGAGCAG
gtgcggtctgggcagcgggggtattcccggctccgcacagacggggccgggggcggcgag
gtgtgaaatgaggcgcgcggagcggccgggacagcgggccgggggtggcaggagaaccgc
caacgcgccccgccggcccccgcgcctgccgccaccgtccacctgcccctctgagcggcc

 1.03 Intr +   5357   5527  171  0  0   41  123    44 0.454   3.63
ttcatttagccccggtctctcatgtggccctctgccgatgcagctcccagatacgaccag
gcctggggaaggagatggtctgatgaggccagcactggggactaaggacgtggagtgagc
aggccagcctgtgggccaggcccaggttgaaccatgttgcttgcctcagtctcttcacag
AGCCCTCAGAGCCCCTCCCTGAGGAGTCCAAACCTGTGGAGATGCCCTTCCACCACTGCC
ACAGGGACCCCCTTCCGCCGCCGGGCCTTACCCCTGAGAGGCTGCATGCACGGAGGCAGC
TATATGCTGCCTGTGCCGTTTGCTTTGTCTTCATGGCTGGGGAGGTGGTCG
gtaagttggggagcagcccttaaaccccattctccaaatacctgcccaagccactctcca
cccagagtcccaggaatgttcctgggtgcagatgcagagatggggatggctgggataggg
gagctgggtgcccaggactcaggaagtaggagggataagggacagcaacaaagggaattc

 1.04 Intr +   5973   6119  147  1  0   39  110   133 0.862  11.32
ataaaatacagatgaatgaaaaaaataacataacagtagttaattatacctgtagtccca
tcacctgagaaaaccccaaatcacatttttggtgtatatcccccaatttattttccatgc
ctatacacactacatgatattttctaaatggaagcagactccatcatttcaccctggcag
GCGGGTATCTGGCACACAGCCTGGCCATCATGACCGATGCAGCCCACTTGCTGGCGGATG
TGGGCAGCATGATGGGCAGCCTCTTCTCCCTCTGGCTCTCCACCCGTCCAGCCACCCGCA
CCATGACCTTTGGCTGGCACCGTTCAG
gtaaggcccctgcatggcccagtgactctccaatcttgccagagggcacccgtcagggtc
ccaagcaggtctctgacagcttgtctccccccccacccgcagagactctgggggctttgg
cctctgtggtctccctctggatggtcactggcatcctcctgtacctggccttcgtccgcc

 1.05 Intr +   6222   6375  154  1  1  107   43   269 0.750  23.94
tgatgggcagcctcttctccctctggctctccacccgtccagccacccgcaccatgacct
ttggctggcaccgttcaggtaaggcccctgcatggcccagtgactctccaatcttgccag
agggcacccgtcagggtcccaagcaggtctctgacagcttgtctccccccccacccgcag
AGACTCTGGGGGCTTTGGCCTCTGTGGTCTCCCTCTGGATGGTCACTGGCATCCTCCTGT
ACCTGGCCTTCGTCCGCCTGCTGCACAGCGACTACCACATCGAGGGGGGTGCCATGCTGC
TGACCGCCAGCATCGCAGTCTGTGCCAACCTGTT
gtacgtcccagtatggagcaggcaccttgtggggcccagggcgaggggtcttcctccagg
atgggagagctggctctctcctccccaccagacacacagacacgcacacacagctctcca
tgggctgccctgcgtgtgcctgagaagggtctgggatagagacctaaaattcagtcagca

 1.06 Intr +   6928   7126  199  1  1   74   76   195 0.664  16.78
ccacatgtgtggcaccaagtctggtattctttcccccaggctgcattgtttatctctctt
gcaaaatgctgttttcttccaggggctgggaaagggctactggggaggtgagacatggag
atgggggtataggaggccaggagcagggccctaggctgaggtgctctgcttacccctcag
AATGGCCTTTGTGCTGCACCAGGCTGGGCCCCCCCACAGCCACGGGTCTAGGGGAGCAGA
GTATGCACCGCTGGAGGAGGGGCCTGAAGAGCCCCTGCCCCTGGGGAACACCAGCGTCCG
GGCGGCATTTGTGCACGTGCTGGGGGACCTCCTGCAGAGCTTTGGGGTACTGGCTGCCTC
CATCCTCATCTACTTCAAG
gtaccatcattggagacctgccccagccttcctccccacaaccacatcccagcccactcc
ttcccaggtcccaaagcttccttcctcctccctccagctcctccctcccacctcccagga
ctctcccagacatgagtcatgttccctgtcccctcttcagggttttgaggggcctctcag

 1.07 Intr +   7387   7492  106  0  1   77  113   123 0.992  13.99
cttcctcctccctccagctcctccctcccacctcccaggactctcccagacatgagtcat
gttccctgtcccctcttcagggttttgaggggcctctcaggtcatgtttgttcaagatac
ccctagatcttcctctgaaaggtccctggttgttgggcttaggggtctctttctctgcag
CCTCAATACAAGGCAGCCGACCCCATCAGCACCTTCCTCTTCTCCATCTGTGCCCTTGGA
TCCACCGCTCCCACCCTCCGAGACGTTCTTCGAATCCTCATGGAAG
gtgagtcgggcaccacagctccccatccctgtggccctctctgactttactctcgcagtg
ggccatcacttttttctttgaagatagtacgggaagaaggcttggctcatggggtctgct
gctggaacaaggatttgggcatagggtgaattgtaggggtcaaaaggagagtgcatacag

 1.08 Intr +   7760   7894  135  0  0   67  109    50 0.982   6.05
tacgggaagaaggcttggctcatggggtctgctgctggaacaaggatttgggcatagggt
gaattgtaggggtcaaaaggagagtgcatacaggataggggaggtggaatccagtggtgg
gggtgctgcttctgggcaggagtagccctagcagtaaggcatgactggtgctggttgcag
GTACCCCCCGCAATGTGGGGTTCGAACCTGTGCGGGATACGCTGTTGTCGGTGCCAGGAG
TCCGGGCAACCCATGAGCTGCACCTGTGGGCCCTTACGCTCACTTACCATGTTGCCTCTG
CACACCTGGCCATCG
gtgagtcacactggccccagctagttactacctggaacataccccaccccaaacatggga
ccatagcttgagttactggaattgtttcagtcttttttgatctgtctctgtttctctgtg
tctctctctctcacatagacacatacacacacacacacatgcacgtgcgctcgtgcatgt

 1.09 Term +   8820   8968  149  1  2   97   52   193 0.943  14.98
gtgagtctctccaacatttgatttgacacttttatgctgttcatacaatacagaaagaaa
agcaggcttccattcacgcctggctttaatgctgtgcagcccctttccctgtccttatct
cagtccctgcctgttctttctcccccgggatggatgccgcctcttatcactctcccacag
ACTCCACCGCTGACCCTGAAGCCGTCCTGGCTGAAGCCTCATCCCGGCTCTACTCCCGGT
TTGGATTCTCCAGCTGCACCCTGCAGGTCGAGCAGTATCAGCCGGAGATGGCCCAGTGCC
TGCGCTGCCAGGAACCCCCCCAAGCCTGA
gccatggccctgccctcaccccactgccaggccgaggctcagccccagactctcagcatc
tgctgccctgatcacagagacgggaccgagccaggtccataccccttcctctctccctcc
taccacctgccagtttccccagcctcagccccagccccagccccagtgggcaagaccaaa

Predicted peptide sequence(s):


>SLC30A3_1|GENSCAN_predicted_peptide_1|423_aa
MEPSPAAGGLETTRLVSPRDRGGAGGSLRLKSRGQLWAPGPEDGPGSARVLRAPGGRAAA
GKRGGGEEGAEPSEPLPEESKPVEMPFHHCHRDPLPPPGLTPERLHARRQLYAACAVCFV
FMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSLFSLWLSTRPATRTMTFGWHRSETLG
ALASVVSLWMVTGILLYLAFVRLLHSDYHIEGGAMLLTASIAVCANLLMAFVLHQAGPPH
SHGSRGAEYAPLEEGPEEPLPLGNTSVRAAFVHVLGDLLQSFGVLAASILIYFKPQYKAA
DPISTFLFSICALGSTAPTLRDVLRILMEGTPRNVGFEPVRDTLLSVPGVRATHELHLWA
LTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRFGFSSCTLQVEQYQPEMAQCLRCQEP
PQA