GENSCAN 1.0	Date run: 16-Jan-104	Time: 00:48:10

Sequence SH3YL1_1 : 40586 bp : 39.87% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   4427   4537  111  0  0   83   82    59 0.809   4.23
aaccttctgggaatgcagcccagtaggtctcagccttatttcacccagctcctattcaaa
atggagtccctctggtttgaacacctctgacaattgtatatgagaagaatgaaataataa
taaatttctcacttctatttagcagaatttttcattaaaatatcttttgttatgtttcag
TGAATAACCCTATACCTTCCAATTTGAAATCAGAAGCAAAAAAGGCTGCCAAAATATTAA
GAGAATTCACAGAAATAACTTCCAGAAATGGACCTGATAAGATCATTCCTG
gtaggtaaataggatgagtgctgtttgtctctaaatgtctttttcctaagttgttttttg
cattgttcgacactccatttcaggcagaagcctccatcaatgccaacaagtagttcagcc
accttttgttccaccaccttttttctcatgactgatccagggatgctttggaaactacta

 1.02 Intr +   7698   7811  114  1  0   67  100   109 0.910   9.50
tcatgggaatagagaggcctcgtgcccatctgttgagtgactgacttttgttcattgctc
ctgtgtgccccgaattcctagagataacctctgtgtacactgactctgtttaacacttgc
tcgtctatccaggcacatagatcaaaatgcttaccttcccattgttttccacgttaacag
CTCACGTAATTGCGAAGGCTAAAGGCCTTGCAATTCTGTCTGTGATCAAAGCCGGGTTCC
TGGTGACTGCCAGAGGAGGCAGCGGGATTGTAGTGGCGCGCCTTCCAGATGGAA
gtaagttggcgtctgttcactggagtagagagtcttcattctttgttctgtctgttttca
tgtgaacacattgcatagcgagtaggacaggtttcctgcatatcaactaaaacttatgta
ataagggctactcgactgaacgtgcagtttggtgtcagtgaacaagccacaggaaccagc

 1.03 Intr +   9940  10004   65  2  2   73  107    28 0.814   0.72
atatttttaactttttaaaaattacatattctttttgaagatcactttaaaatcagggga
aataccaagtctcattattttcaatagaagcactctttagattttagcatttttccttcc
tatatttacatgtcgagggtgttttaatgttaggataacgttcgtttgtttttttattag
AATGGTCTGCACCCTCAGCCATTGGGATAGCTGGCCTTGGTGGAGGATTTGAAATAGGAA
TTGAG
gtaagtagcttgtgcacgtccatacaactgccatatcctctgaagacacctaagatgcaa
cctgtgaaaactgagaggtttcctagcgttcttattgttaccattggcacttaggaaaaa
ttgtttcctttattttctcgatgaatgtctaactaaagctatctgatggttcccatttac

 1.04 Intr +  10501  10600  100  0  1   63   72    64 0.233   1.06
aagccactgttctccttcagtgggcattgaaattacgtgggcagtgcatcatcatttgtg
gcaaaatccagttttgtaacatatgatattcaaatccctccacattctttaagtaaagaa
gaacttcacgttatttcagtttataatgttgctcctgggattgtggcgtctgtcgggcag
ACATGCACACTCACAGAGGCCTCCTACACGGGGATCCTCTTAGGGCTGATGCTCATCTTC
AGTCTGTCGTTTTGCAAGGGCCTGGAAATTGAATCTCCTG
gtatgctcaactcattttcttctcaaatttcagtccatttcttcctaagctatcctttgt
agatttgccctgttgacatagttgtaaattccctcagccttattaggaggaagtatttct
aactcttttttcatctttattcaatctttcttactcactgctgtataaatttgtagtata

 1.05 Intr +  18855  19066  212  1  2   48   63   105 0.329   1.71
aatacgtgtatctggattagggattaatttgggggagggggaagtttttgtggtaaagag
agagagattagtaaagagagttgagattgtgagaagtgaagtcgtgaaagtcagtggtct
gaggaaagacaatgctacatttgctttaaataccactaacggtttctttttggatgacag
TTGTAGCAAAGCCCAAAGCTCAGAAAGTCCTGCTGCTGGCTTGGCTTTGGACATGTACAG
TCCTTTGCTGTGTTTCCAGAGCTAGAGCTCACACTGGGTCATCAAGCCAGAGCAGTCTGG
CTTTTACTCAAGATTGGAATTTGAAAAAACAAAAACGACTGCTTTTTCCAGGGAGAATTT
ACATGGGCCCTTTCACTTTACTGAAGAGGAAG
gtatttgggtttaagttgaggataaattattgttagagatcagagtccagtttctaagcc
ccctaagaatgggatgtaaggaaaagatctgttggtctgaggaatggagggggtgttgtt
gctggaaggacgctccacttaagcttggtttacatattgagactggccatgccacacaca

 1.06 Intr +  22762  23022  261  0  0  -33   97   208 0.475   6.36
ggttgcagtgagctcagatcacgccactgcactccagcctaggcaacaagagtgaaactc
tttctcaaggaaaaaaaaagaaaaattaagtcatggaaataggcattcctaatggaaact
gctttgctttctggtgtgttgagcttctgtgacctatagtgaagtggcccaggttcacag
CTTCCTGGTAAGGAGCACACCCCTGGCCAGGAGGAGAGTGTAGAAAGGCTCTCAGGACCT
TCAGCACCATCGTCCCTGGTGCTGTGCTCTTCGGGCTTGGCTTTTACAAAGTTTAGTCTG
ATGAGATCAGAGAGCATGTTGGATCCCTTCCAACAACCTTTGTTTGACTTGTTAGCACTG
ACGGTTTACCTAACCCCACTAAACCTTAGGATCACCACCTACATGACCAGGTTGTGTGGA
AGATTGAAGGACATGATGCAG
gtaaacctcatagtatacacatggtgcacagtaaatgctcgctgaggtttgttgtaatta
cctgtggcaatattggcttcataattcatcagctcaaaataaaaatatggctcttgtctc
acgttctttcctgtctctattgatgttttgctacagtgcatatggtgtagttgagtgtta

 1.07 Intr +  23270  23382  113  1  2   71  113   158 0.999  14.86
caatattggcttcataattcatcagctcaaaataaaaatatggctcttgtctcacgttct
ttcctgtctctattgatgttttgctacagtgcatatggtgtagttgagtgttagtcaaga
tgaattttaaatgatatttagtcttaacgatttttaaatccatgggtttctacactttag
GTATCAGACTTGGTGATAATTCTGAATTATGACCGTGCTGTAGAAGCTTTTGCAAAAGGC
GGAAATCTGACCCTCGGAGGGAACTTGACTGTGGCGGTTGGGCCCTTGGGAAG
gtgagttctttaaatagatgttagacagtaaaggtttaacaactgcatattttattttgc
attaataggaaacttgaattaaaatgaacagatttgtacatccccagatttatacatgcc
cgaaagatttgaggtcatcacaaataggaaattcacaaaacacagccagtgagataagct

 1.08 Intr +  24313  24441  129  1  0   93   32    99 0.783   3.69
tttttcctctaggccacattaaaacatctaatttaggcctacagtaagtaaaacatagaa
acagctgaagaaggtacagaacaaaataattcatttgagctagaaggagtgctatttaaa
tagtgatcctcggcttggagctgctcacagctttgtgatgcaaaatcttgtgctttgcag
GAACTTGGAAGGAAACGTGGCCCTGAGAAGCTCCGCTGCCGTCTTCACGTACTGCAAGTC
AAGGGGACTCTTTGCAGGCGTGTCTTTAGAAGGGAGCTGTTTGATTGAAAGGAAAGAAAC
TAATAGAAA
gtcagttcaagttaaagtgattttaattgaaagtgtgatgagaaaatagtacttcaaaag
ttgatataatttgcagagtacatttatatattctttttacaacatgtggttttaagtgtg
tatcttacatttaaaaattaaatatacaaataatatatgctcgtagaaaatgcagaagac

 1.09 Term +  26351  26573  223  2  1   65   42   241 0.990  12.61
ggggtacatttaagacttgaacatgggatattgcttaaagttagtgtttaaaaagtagtg
tatatgaagtgctatgtatgaatgattatatatacacaccgtgtgtgcgcacatgctatg
tttaactctagaaaagatttgtgtatattaaaatgtttttaattttatatttcccattag
ATTTTATTGTCAAGATATCCGAGCTTATGACATTTTATTTGGAGATACACCGCGGCCTGC
TCAAGCCGAAGATCTTTATGAAATTCTTGATTCCTTTACTGAAAAGTATGAAAATGAAGG
ACAACGAATCAATGCAAGAAAAGCAGCAAGGGAGCAGAGGAAGTCTTCTGTACCGTTTGG
TTTTATGTTTCACTCAGTATTCTCAGAAAATCTCTTTCTGTAG
aacattctgtccctgatatcaggttcctaagaacctactaagcctccttcgtagtttcac
tgacttcacattcttgtgaaaaggtcatgctaccttgacatttcctctgtacagatttca
gggaaaaacataatttgtcctctgtgattgcatttctccaaggatggaactttgttgtat

 2.01 Init +  37744  37795   52  0  1   53   81    26 0.597  -0.23
gctcagttctcaaagtattttcttccttctgcaatacatggatatacacattgcattgaa
gtacttgtgaaacatgtagaaatgctcctacctgtgctaattccaacttatctctgatat
tgagaggatggatcaattaagcacagaaatgtaaacagccacaaagcccagggagaagaa
ATGTCTGCTGAGGAAACAGCAAAATATAACTGGGCTGCAATCTTCAAGCCCA
gtgagtaaagagccaggttttaaagttgaatctcctagggtttgatataagctcacatat
ctgcctttctccagcatctgccatccatgaaactgtcacactatcttggccccttccagc
tgctgtaacaaaacaccatagtctgggcagctcatagacaatggaattttatttctcacg

 2.02 Term +  38541  38731  191  1  2  112   42   146 0.783   9.03
aatgtgcagagaaaaataagtttaataatgtgatgaaaattacacagactgttgtggttt
ctgccagcctccaagacatcagcatgccaagccctaagtggttaatttttatcttaccag
cagatacccccaatttctcccttaaagaacataaacgtgaatacttttttcttgtttcag
GCAATTTGAATCAACCCATAGAAGTGACAGCGCTGTATTCATTTGAAGGACAGCAGCCTG
GGGATTTGAATTTTCAAGCTGGAGACAGAATCACAGTTATATCAAAAACAGATTCACATT
TTGATTGGTGGGAAGGAAAACTTCGAGGTCAAACTGGCATTTTTCCAGCCAACTACGTAA
CCATGAATTAA
agcgtatactattttcttctttgagaattacaaaaaaattatttctacactgacaggatt
tactagttaagcaatgtttaatataaattttaaaaaacttctgttctacaaaatttccat
tccgtatgtaaaagattttgtttttctatataaaaagagctgactgacatatctttaaat

 3.02 PlyA -  39426  39421    6                              -0.45
 3.01 Term -  39878  39680  199  1  1   66   55   160 0.864   6.39

Predicted peptide sequence(s):


>SH3YL1_1|GENSCAN_predicted_peptide_1|442_aa
XNNPIPSNLKSEAKKAAKILREFTEITSRNGPDKIIPAHVIAKAKGLAILSVIKAGFLVT
ARGGSGIVVARLPDGKWSAPSAIGIAGLGGGFEIGIETCTLTEASYTGILLGLMLIFSLS
FCKGLEIESPVVAKPKAQKVLLLAWLWTCTVLCCVSRARAHTGSSSQSSLAFTQDWNLKK
QKRLLFPGRIYMGPFTLLKRKLPGKEHTPGQEESVERLSGPSAPSSLVLCSSGLAFTKFS
LMRSESMLDPFQQPLFDLLALTVYLTPLNLRITTYMTRLCGRLKDMMQVSDLVIILNYDR
AVEAFAKGGNLTLGGNLTVAVGPLGRNLEGNVALRSSAAVFTYCKSRGLFAGVSLEGSCL
IERKETNRKFYCQDIRAYDILFGDTPRPAQAEDLYEILDSFTEKYENEGQRINARKAARE
QRKSSVPFGFMFHSVFSENLFL

>SH3YL1_1|GENSCAN_predicted_peptide_2|80_aa
MSAEETAKYNWAAIFKPSNLNQPIEVTALYSFEGQQPGDLNFQAGDRITVISKTDSHFDW
WEGKLRGQTGIFPANYVTMN

>SH3YL1_1|GENSCAN_predicted_peptide_3|66_aa
XRVCWVKPGLKQGVYAGAGAERAARFRVGMGERKYWVSECLKGNRISGGFNRGHEIEERK
LALKSP