GENSCAN 1.0	Date run: 15-Jan-104	Time: 21:16:39

Sequence RRM2_1 : 10287 bp : 46.47% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1392   1490   99  2  0   59  101   198 0.988  16.51
atgggaagggtcggaggcatggcacagccaatgggaagggccggggcaccaaagccaatg
ggaagggccgggagcgcgcggcgcgggagatttaaaggctgctggagtgaggggtcgccc
gtgcaccctgtcccagccgtcctgtcctggctgctcgctctgcttcgctgcgcctccact
ATGCTCTCCCTCCGTGTCCCGCTCGCGCCCATCACGGACCCGCAGCAGCTGCAGCTCTCG
CCGCTGAAGGGGCTCAGCTTGGTCGACAAGGAGAACACG
gtgagcccgcggggagggcgctgcgggcaggggagggaggcagggaaagcgaagccgctc
ctcactcacacgcgtctccccgcagccgccggccctgagcgggacccgcgtcctggccag
caagaccgcgaggaggatcttccaggagcccacggagccggtgagtggcgggcgtggggc

 1.02 Intr +   1576   1650   75  0  0   87  117   107 0.999  13.21
tctccctccgtgtcccgctcgcgcccatcacggacccgcagcagctgcagctctcgccgc
tgaaggggctcagcttggtcgacaaggagaacacggtgagcccgcggggagggcgctgcg
ggcaggggagggaggcagggaaagcgaagccgctcctcactcacacgcgtctccccgcag
CCGCCGGCCCTGAGCGGGACCCGCGTCCTGGCCAGCAAGACCGCGAGGAGGATCTTCCAG
GAGCCCACGGAGCCG
gtgagtggcgggcgtggggcagaggggccagggacggccttgggcgtcttggcgccaaag
ccgcattgtttcctcagctgttcacactcccgccccggctcctttcccgcctaggcggcc
cctccccagggctgcctcccgcgcccctcggcccatttcccggttcgggcgtgcgctcct

 1.03 Intr +   1980   2123  144  2  0   98   74   187 0.911  18.78
ggcccatttcccggttcgggcgtgcgctcctctgctgcgacccacggagtgcgacgggac
agccacgttttcacatcgggccccgtgaaattgccgccaatggaaaggacttggtccaga
aaaacgttagtttcatatggttcgcccggtacttaaatgttttattttctcccccaacag
AAAACTAAAGCAGCTGCCCCCGGCGTGGAGGATGAGCCGCTGCTGAGAGAAAACCCCCGC
CGCTTTGTCATCTTCCCCATCGAGTACCATGATATCTGGCAGATGTATAAGAAGGCAGAG
GCTTCCTTTTGGACCGCCGAGGAG
gtaatcggaggaccccagaagacccctgcaggggtgaccgtcacgcctcagacataaatg
cacttggaggttcccgttggcaaggggggctaactgtggggcatagtaagtggtgccagc
atacttaaagtttgagtgctcagtgtgagtcctgtaggctttactctcttccttttatgc

 1.04 Intr +   3310   3443  134  0  2   94  113    71 0.999   9.64
tttcctgatatgtaagttgagcatatgacataaaatatcaaagaattgtgacaaattgga
tgaaatatatatagaaataaaccttataatggtacaaagagtgcgatgctgccagtatcc
gttgacagttgctgctgttggttttttctcaagcttaactttgatgtgttttgccactag
GTGGAGCGATTTAGCCAAGAAGTTCAGATTACAGAAGCCCGCTGTTTCTATGGCTTCCAA
ATTGCCATGGAAAACATACATTCTGAAATGTATAGTCTTCTTATTGACACTTACATAAAA
GATCCCAAAGAAAG
gtgagtattcaagtggtatgccaagatttttaggactcactaattgttgatttattacac
atttttagttcacctagggataaaaatgactccagaatgactaagacagtcataggcatt
cccagcacccgtggtcatgtctgctcttagcaaggggcctaaatgcactttattattcac

 1.05 Intr +   5468   5562   95  2  2   70   91   140 0.999  12.11
aacactggagggaaaaactgaccagtaaaaataaaacatttcggtgtgagttcttccttt
aggaagaggattggcaaatacttgaatttggcctttgtcccagagctcttatctagcagt
tggtaatcggaggtcttttactgtaatgcttcaattgctgataccgtatgtgcctactag
GGAATTTCTCTTCAATGCCATTGAAACGATGCCTTGTGTCAAGAAGAAGGCAGACTGGGC
CTTGCGCTGGATTGGGGACAAAGAGGCTACCTATG
gtaaggagacccttgcccctacttaaacctgagcttcattttccaagtaatgttactgga
tttttggcccttgaataccaactcactagaatcatgttggtgttaactcctaaataggtg
aacgtgttgtagcctttgctgcagtggaaggcattttcttttccggttcttttgcgtcga

 1.06 Intr +   5680   5813  134  2  2   39  105    22 0.974  -0.64
cttgtgtcaagaagaaggcagactgggccttgcgctggattggggacaaagaggctacct
atggtaaggagacccttgcccctacttaaacctgagcttcattttccaagtaatgttact
ggatttttggcccttgaataccaactcactagaatcatgttggtgttaactcctaaatag
GTGAACGTGTTGTAGCCTTTGCTGCAGTGGAAGGCATTTTCTTTTCCGGTTCTTTTGCGT
CGATATTCTGGCTCAAGAAACGAGGACTGATGCCTGGCCTCACATTTTCTAATGAACTTA
TTAGCAGAGATGAG
gtgagtctaagtcaaataatagggtgacctaaaccccaaacacaactcgggcatgctctt
gtgttcactgacggggacctgagatgctagatggcatatatccacatttaatgtgtgagt
tcaaccatacacatacttgacaaaagaaggaaatactttcatttactgaaactgttttac

 1.07 Intr +   7441   7545  105  0  0   92  103    78 0.998  10.11
ggtagtgacatcagcagagaagtcagtagttgaagtcatcttccctttgagagttcaagt
gctctcagtatggctgagcatgttggataaggagaatgcagaaaaggacaaagtaatttc
atattccatgttaatgacagaagtcttctggctttagtgatcttgaacttttttttctag
GGTTTACACTGTGATTTTGCTTGCCTGATGTTCAAACACCTGGTACACAAACCATCGGAG
GAGAGAGTAAGAGAAATAATTATCAATGCTGTTCGGATAGAACAG
gtaaagtgggtgatgaaatgggtcactcaagcttgctagaaaatgcctgtgctttagttg
tattcagaagctgtattttggttcctaggagttcctcactgaggccttgcctgtgaagct
cattgggatgaattgcactctaatgaagcaatacattgagtttgtggcagacagacttat

 1.08 Intr +   7634   7747  114  1  0   41   98    55 0.842   2.44
attttgcttgcctgatgttcaaacacctggtacacaaaccatcggaggagagagtaagag
aaataattatcaatgctgttcggatagaacaggtaaagtgggtgatgaaatgggtcactc
aagcttgctagaaaatgcctgtgctttagttgtattcagaagctgtattttggttcctag
GAGTTCCTCACTGAGGCCTTGCCTGTGAAGCTCATTGGGATGAATTGCACTCTAATGAAG
CAATACATTGAGTTTGTGGCAGACAGACTTATGCTGGAACTGGGTTTTAGCAAG
gtaaagtattgtttacatagccttttgcttgttttgaagctggtgctctgtatttatatc
ttgatgtgaaccttttcaggttttcagagtagagaacccatttgactttatggagaatat
ttcactggaaggaaagactaacttctttgagaagagagtaggcgagtatcagaggatggg

 1.09 Term +   7827   7979  153  2  0   76   36    84 0.984  -0.08
aggccttgcctgtgaagctcattgggatgaattgcactctaatgaagcaatacattgagt
ttgtggcagacagacttatgctggaactgggttttagcaaggtaaagtattgtttacata
gccttttgcttgttttgaagctggtgctctgtatttatatcttgatgtgaaccttttcag
GTTTTCAGAGTAGAGAACCCATTTGACTTTATGGAGAATATTTCACTGGAAGGAAAGACT
AACTTCTTTGAGAAGAGAGTAGGCGAGTATCAGAGGATGGGAGTGATGTCAAGTCCAACA
GAGAATTCTTTTACCTTGGATGCTGACTTCTAA
atgaactgaagatgtgcccttacttggctgattttttttttccatctcataagaaaaatc
agctgaagtgttaccaactagccacaccatgaattgtccgtaatgttcattaacagcatc
tttaaaactgtgtagctacctcacaaccagtcctgtctgtttatagtgctggtagtatca

Predicted peptide sequence(s):


>RRM2_1|GENSCAN_predicted_peptide_1|350_aa
MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKT
KAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVERFSQEVQITEAR
CFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEA
TYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKH
LVHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSK
VFRVENPFDFMENISLEGKTNFFEKRVGEYQRMGVMSSPTENSFTLDADF