GENSCAN 1.0	Date run: 16-Jan-104	Time: 00:14:53

Sequence REL_1 : 43570 bp : 38.32% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1335   1386   52  2  1   97  117    49 0.589   6.26
tggacggcgacgctgggtgacccggggtgcaagaattcaggggttgggaaggtgtgagcc
gcaaacccagcggagggcgggaagaaggaggaggcctctagggtggtcgggggactgggg
gccccgccggcagaggtccctcggcctcctgactgactgactgcggccgcctccggccag
GACGCTGGGAGCTGCCTGCGGGAAGGTGCGGGGAGCGGAGCCATGGCCTCCG
gtgagtgttcatggggcgcgggcctgggccgggggaaaggagctcttctgaagggggtcc
tgccgcagtgagtttagggagctcagtttttgctggggcgcgttctgtctttaaaatctc
atatggtaaaattgtcagcttttaaaaaagttacctgcttcagggtttgcgtgcagaatc

 1.02 Intr +  11219  11361  143  0  2   96   90   152 0.997  15.35
gggaaaaaaaggtgcctctcccagccaatctccaagataacatttcggtcttgttattta
atgttaggaggaaaaaaatctttgttttagtctgctgttataaaaaaaacagaatgttaa
aatccattattaattgctatattaatctcactgacctcctcctttttaaaaacttttcag
GTGCGTATAACCCGTATATAGAGATAATTGAACAACCCAGGCAGAGGGGAATGCGTTTTA
GATACAAATGTGAAGGGCGATCAGCAGGCAGCATTCCAGGGGAGCACAGCACAGACAACA
ACCGAACATACCCTTCTATCCAG
gtaatagacccttcttctgtgtctatctcactattagttgcttcatatactagctatagc
aattattttaaagggccagtttcttcacagtcatctccacaggtttatctttttcttttt
tcctttttttttttaaacggatctgtcaaaaagacatctattagatagatgtctaaggac

 1.03 Intr +  13933  14081  149  0  2   79   81   167 0.968  13.21
aagtttttctgtactggtattctctggaaagtttcatctaaactgcagttgttcgtcagc
tggattttatttatctagtgccaattacattataattaatgtaaattgaattctcattta
gtagatcagtttataatgcagtctatttggatcatgtatttaatttcccccttttttcag
ATTATGAACTATTATGGAAAAGGAAAAGTGAGAATTACATTAGTAACAAAGAATGACCCA
TATAAACCTCATCCTCATGATTTAGTTGGAAAAGACTGCAGAGACGGCTACTATGAAGCA
GAATTTGGACAAGAACGCAGACCTTTGTT
gtaagtacacagttacagacatcttcagaaataagataagacataggatgttctgtttct
tctccatgacaatctgttactttttagcagaataattttctcattctacttctatttact
gtattttacacttacatttttactatttgcattagaactaccctttcattctttattagt

 1.04 Intr +  20528  20619   92  2  2   65  115    83 0.934   7.42
gcgcccagccatataatcccacttcttactctctcatctttatcagagcaattggaagca
cgttcatgctttggtatgtacaactgacagcatgataacttcagtattgctatatgtttg
atttttgcaatattccttgtgtttataatgcagttttgaatattgtttttttcctgctag
TTTCCAAAATTTGGGTATTCGATGTGTGAAGAAAAAAGAAGTAAAAGAAGCTATTATTAC
AAGAATAAAGGCAGGAATCAATCCATTCAATG
gtaagtatgtttgataaaatcatttctatttatttgggtgttgatttctgtttctttttt
ctttctctttttttttttttttttttttttgagacggagttttgctcttgtcgccaggct
ggagtgcaatggcgcgatctcagctcactgcaacctccgcctcccaggttcaagcaattc

 1.05 Intr +  36413  36553  141  0  0   79  103    74 0.961   7.40
tagtgattacttgataagaatgataaaaggcattcttgagattgtatactgttctatttt
tattcatacatatttggatgctattcaaggttattggctataatgggcagggaggaggac
ctagcaagtctttaggtctatgtgactattacatttaaaaaattttttttttctattcag
TCCCTGAAAAACAGCTGAATGATATTGAAGATTGTGACCTCAATGTGGTGAGACTGTGTT
TTCAAGTTTTTCTCCCTGATGAACATGGTAATTTGACGACTGCTCTTCCTCCTGTTGTCT
CGAACCCAATTTATGACAACC
gtaagtacttcattttcttatatttgtagtcttaacttgttttttgtaatagtttaattc
ttaaaattattttggtaattaggaaaacaatatattcatgataggaaaacttccagacat
tagagaaatatataacagaaaggaaatcttctctaatctcatcctccagagataatcact

 1.06 Intr +  37930  38142  213  2  0   69   86   205 0.999  16.16
aggatttgtcgtgtaaacaagaattgtggaagtgtcagaggaggagatgaaatatttcta
ctttgtgacaaagttcagaaaggtatttatttatttcattgaatttagaataaattttag
attaatagatgcagttactttgttttcccatttttttttttttggtttcttattgactag
ATGACATAGAAGTTCGTTTTGTGTTGAACGATTGGGAAGCAAAAGGCATCTTTTCACAAG
CTGATGTACACCGTCAAGTAGCCATTGTTTTCAAAACTCCACCATATTGCAAAGCTATCA
CAGAACCCGTAACAGTAAAAATGCAGTTGCGGAGACCTTCTGACCAGGAAGTTAGTGAAT
CTATGGATTTTAGATATCTGCCAGATGAAAAAG
gtatgacattttgctggtaataatttatatatttcttgaagtggtcctgctaataacatc
ttcttgtaatattcatttgagtacagttatgtatattcataatttatgtttcttttcctg
gaagctttctgttggttttttctttatgctctttgcatctctttatttgttgggttgttt

 1.07 Intr +  39577  39645   69  2  0   72  107    75 0.985   6.04
aaaatatccttttctactgatactactgatttgggacatattctataatacttattaaat
ccaacttacatacatatttattgaaaacattttctatatgtgaataaaatatttgtttat
taaaggagaggatacaatcctataattttttatctgctttcctggtttctttctaatcag
ATACTTACGGCAATAAAGCAAAGAAACAAAAGACAACTCTGCTTTTCCAGAAACTGTGCC
AGGATCACG
gtaagaatagtttggatcgattcatatttaaataggttttgttttatttactttattcag
tttttcaaattttattatttttgttttgttttgttgtttgtttgttttttgagatagcat
ctctctctgtcacccaggctggagtgcagtagggcaatctcaactcactgcaacctctgc

 1.08 Term +  41299  42071  773  2  2   97   32   391 0.947  26.96
ttcattttggattcgtgtaataattttagtgctttttacatttttttatttgaaatgtta
cattggtttccttgacatttttctttatatatatttgtgtgcttatgcaattttaattta
gaaatgctttttataattttgttcattttaatttcgtaaaataaatttttcctcccacag
AACCAAACTTGTTTTCTCATGATGCAGTTGTGAGAGAAATGCCTACAGGGGTTTCAAGTC
AAGCAGAATCCTACTATCCCTCACCTGGGCCCATCTCAAGTGGATTGTCACATCATGCCT
CAATGGCACCTCTGCCTTCTTCAAGCTGGTCATCAGTGGCCCACCCCACCCCACGCTCAG
GCAATACAAACCCACTGAGTAGTTTTTCAACAAGGACACTTCCTTCTAATTCGCAAGGTA
TCCCACCATTCCTGAGAATACCTGTTGGGAATGATTTAAATGCTTCTAATGCTTGCATTT
ACAACAATGCCGATGACATAGTCGGAATGGAAGCGTCATCCATGCCATCAGCAGATTTAT
ATGGTATTTCTGATCCCAACATGCTGTCTAATTGTTCTGTGAATATGATGACAACCAGCA
GTGACAGCATGGGAGAGACTGATAATCCAAGACTTCTGAGCATGAATCTTGAAAACCCCT
CATGTAATTCAGTGTTAGACCCAAGAGACTTGAGACAGCTCCATCAGATGTCCTCTTCCA
GTATGTCAGCAGGCGCCAATTCCAATACTACTGTTTTTGTTTCACAATCAGATGCATTTG
AGGGATCTGACTTCAGTTGTGCAGATAACAGCATGATAAATGAGTCGGGACCATCAAACA
GTACTAATCCAAACAGTCATGGTTTTGTTCAAGATAGTCAGTATTCAGGTATTGGCAGTA
TGCAAAATGAGCAATTGAGTGACTCCTTTCCATATGAATTTTTTCAAGTATAA
cttgcaagatttaaatccttttaaatcttgataccacctatatagatgcagcattttgta
tttgtctaactggggatataatactatatttatactgtatatataatactgactgagaat
ataatactgtatttgagaatataaaaaacttttttcagggaagaagcatacaactttgga

Predicted peptide sequence(s):


>REL_1|GENSCAN_predicted_peptide_1|543_aa
DAGSCLREGAGSGAMASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRT
YPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLG
IRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTA
LPPVVSNPIYDNHDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKM
QLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFQKLCQDHEPNLFSHDAVVREM
PTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTL
PSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSV
NMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFV
SQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEF
FQV