GENSCAN 1.0	Date run: 15-Jan-104	Time: 22:48:10

Sequence PTMA_1 : 7413 bp : 61.58% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   2202   2290   89  2  2   98   54   176 0.999  13.42
gacgggcttatccgctttgggcgctctgggaggcgggggtgggcgcccttcgaggtgagt
gcgccgggagcggccgcccagcttcagtcatgcacccgcggtgccgggcttggctgagga
ggcgagagcccacgcgccgcagggaggaaagagaaagtgaagcgcggcgctggggcgacg
ATGGGCGCCCCCCGCGGCTGCCCGGGAGCACCGTGTGCGCCGCAGCTCGGGGCGACGCGG
GCCAACACGGCGGCCGCGACAGGCCAATG
gtagggtcgaactgggggggcgcccgggccccgtggcgggttcactgccctcggctatga
ggtcctgcgcggctggtgcggctccgctcctgttgtcggcgccgcctcggtcccactgcc
cgccctgggtagcgtctccgcccttggcgggagcggggcgctctcagactgactggctct

 1.02 Intr +   2516   2739  224  2  2   92   57    80 0.631   4.30
tgccctcggctatgaggtcctgcgcggctggtgcggctccgctcctgttgtcggcgccgc
ctcggtcccactgcccgccctgggtagcgtctccgcccttggcgggagcggggcgctctc
agactgactggctctttcttaatatttcggccctcgtccgcgcccgtcgtgcccctgcag
GGATTGGCGCGAGTCACCTTGGCGTCTCCTTAACCCTTGTGTCCCTGGCGTCATCTCTGA
CTCTCCCAGGGGCGACTTCTTGGCAGAGCGGAGCTCGGGGCCCGGATCTCCACAGGGGCT
CTCAGTGACCCCTTCTGGACTCAGTCCGGGAATGAGTTTGTGGGGTGAGAACACCGTCCC
CAGTGCGGGGCCTGGCTGTTCGATTTTCTCCGAAGCACCAAAAG
gtgacttcccgcgagggcgatgagtagtagcccgagaggcgcatccccgacagtctcgga
cctacgcagcccggtggactttggggcgacctcccgtgggacttggcccgccgaatgcag
acattcgggcctgccggggtggcggcagtggggcgtcgagtcgagagcccggccgaccga

 1.03 Intr +   2860   3023  164  2  2   33   74    77 0.836   1.69
gtgagaacaccgtccccagtgcggggcctggctgttcgattttctccgaagcaccaaaag
gtgacttcccgcgagggcgatgagtagtagcccgagaggcgcatccccgacagtctcgga
cctacgcagcccggtggactttggggcgacctcccgtgggacttggcccgccgaatgcag
ACATTCGGGCCTGCCGGGGTGGCGGCAGTGGGGCGTCGAGTCGAGAGCCCGGCCGACCGA
CGCGCGACCCGCGCGCGTGCCACTGCAAGCTCTGCCTGCCGGCCGGGAGTCTCCAAGGCA
AGGGACGCACTCGGCGGCCCCGGGCCACGTGCTCCCTGCGCGCG
gtgcgtgccgaggcccgcgcgcaaagcccgccgggcgggggatgcgcgcctgcgcgccgc
gacctccctgcccccactgctccccggggcttcggccgccagggggcgagagcgggcgga
gccggggtccgcggagcggagcggggcgggccggactgagagggccgacaggtggcccgg

 1.04 Intr +   4023   4094   72  2  0   61   68   105 0.702   6.55
gccttccttccaccagaccagtgggagagggaccgcaggggcatcaggcctttctcaaca
tgcgactcttaatttgggacggacagaacagccgtacagaccagtagttctcagcgcctt
tgcttaccctgggttgctcagaagacttactggttactggttccttcttcccttttgaag
GACTTAAAGGAGAAGAAGGAAGTTGTGGAAGAGGCAGAAAATGGAAGAGACGCCCCTGCT
AACGGGAATGCT
gtgagtgtctgctttgctcctgagccctggcagctaccgccccacaaaatttttcctgtt
ctactttaaacatacctatatatgtgtgtgtatgtgtatatgtatagctttgcacagtgg
cagtatcgtagccaatgagctttacccgaggcgcgattattgctagttaaatatttataa

 1.05 Intr +   4562   4658   97  1  1   52  101   176 0.975  16.04
atgtgcaggtttcatgatggagcctggagggtgttgactggagaagggtctctggggtgg
gcttggcttggctgggctgtagatgcagccgccagcctctggtgggaggccgggcatcag
gagcaacgctctgtccagcctggggccagctggtaatgacatggcctgttttctgtcgag
GAGAATGAGGAAAATGGGGAGCAGGAGGCTGACAATGAGGTAGACGAAGAAGAGGAAGAA
GGTGGGGAGGAAGAGGAGGAGGAAGAAGAAGGTGATG
gtgagtagccttgtctatcttccccttttcaggtactttttcctggccttgtctggcaga
aggggaaggaaggaattggggctcctgggagtgggacaatggtacttggggccagtggac
cacatggccctgggcacccacctgtagagtcagggaaggtctccctgacatggagttgtg

 1.06 Intr +   5118   5191   74  1  2   77   90   137 0.999  13.08
tgggcctctctcctctggagagtcccacctgtgtagtgggcgtgggtgccctgattgggc
ccagttgcaggcagtagaggcagggcagggaccttgcagtccactacatgttcctcggga
tttccccaggagccacagtaggagggaagtgtggtttacctggcctttgattctctccag
GTGAGGAAGAGGATGGAGATGAAGATGAGGAAGCTGAGTCAGCTACGGGCAAGCGGGCAG
CTGAAGATGATGAG
gtgggttctggcttgagaagaaggggggtttggcatctgggtctccccacctgcctttag
ctgaggtgctcaagctgcggagggactgtttctgactttgtaggtggccactgtgtggtc
ctgaatcttaagaacaggaaggaaacagggctgggctcaacttcccagaggccttgggct

 1.07 Term +   5479   5526   48  0  0   65   42   156 0.990   6.90
ccactgtgtggtcctgaatcttaagaacaggaaggaaacagggctgggctcaacttccca
gaggccttgggctgtggagctgggggtccctggttcttgctctgccagcaggagctgagg
cagtgggctggatagggctcctggggttggaggggcctttgacagtctttctctgcttag
GATGACGATGTCGATACCAAGAAGCAGAAGACCGACGAGGATGACTAG
acagcaaaaaaggaaaagttaaactaaaaaaaaaaaggccgccgtgacctattcaccctc
cacttcccgtctcagaatctaaacgtggtcaccttcgagtagagaggcccgcccgcccac
cgtgggcagtgccacccgcagatgacacgcgctctccaccacccaacccaaaccatgaga

Predicted peptide sequence(s):


>PTMA_1|GENSCAN_predicted_peptide_1|255_aa
MGAPRGCPGAPCAPQLGATRANTAAATGQWDWRESPWRLLNPCVPGVISDSPRGDFLAER
SSGPGSPQGLSVTPSGLSPGMSLWGENTVPSAGPGCSIFSEAPKDIRACRGGGSGASSRE
PGRPTRDPRACHCKLCLPAGSLQGKGRTRRPRATCSLRADLKEKKEVVEEAENGRDAPAN
GNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDE
DDDVDTKKQKTDEDD