GENSCAN 1.0	Date run: 16-Jan-104	Time: 00:23:36

Sequence PLEK_1 : 34558 bp : 41.20% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1261   1302   42  0  0   94  105    46 0.327   7.37
ctgatcttccaacccagtgaggggaagaggatgtgatcatgcgaccgccagcagaaggga
aattgtgaaagcgacctgctgtagaaaaggcggcccacagccacctcagcatgcagagga
ggcccagctgctgagaggagttgcctgagagtgacctttgcatctgcctgtccagccagc
ATGGAACCAAAGCGGATCAGAGAGGGCTACCTTGTGAAGAAG
gtgagcgaaggtgccacttaccagggtgtcagtggacatgggctggggagacttgggttc
agctccaccggctacctgctcatcttaggaatgtttcctgttcaaccagttgggttgaaa
taggggagcgtggtagcacatagaatgttggagtggggttaggggagtggggatactcat

 1.02 Intr +   9277   9324   48  0  0   53   96    57 0.183   0.96
gtagtggtgaagaggagagaaaaacctcctcaaattccatcatcctgacctaactcagca
ctatcaggcctggaaggatgtttaagctttgtaagtggtcagatttctcttgtttcataa
agtatcagcctcttcattgtgcataatgaccctgaatcccaaatgacacatcctcctcag
AGTCAGACCCCGGAGGCTGCACTTGATTTAGAAAAGCACAACGTGAAG
gttagttacatatgtatacatgtgccatgttgttgtgctgcacccattaactcgtcattt
aacattaggtatatctcctaatgctatcccaacatggcacgtgtatacataggtaactaa
ccttcacgttgtgcacatgtaccctaaaacttaaagtataataaagaaaataaaaaaaaa

 1.03 Intr +  16237  16392  156  0  0   97  115   131 0.993  15.99
aatgagaatggctccccaagtagccactgatttgagaggatttgtgttgaaggaacagag
atgatgtcaccaaacattttaaaaaccaactgtaagtaaatatagaatctttcctgttag
gaggaaaatacagtttgcaaagagccctgtccatctcagctcttttggttgtcattacag
GGGAGCGTGTTCAATACGTGGAAACCCATGTGGGTTGTATTGTTAGAAGATGGAATTGAA
TTCTATAAGAAGAAAAGTGACAACAGCCCCAAAGGAATGATCCCGCTGAAAGGGAGCACT
CTGACTAGCCCTTGTCAAGACTTTGGCAAAAGGATG
gtaagttgacatcatgagctgccgtgaacccctggtcaggcactcaacttttggtgcaag
cattgcctacaatgtgggtggtgctccttgggctggtccctctcaccaccacccacaccc
caccctggcatttgggtttctcttggctagaagaggtttaggccaatggcctctgcttca

 1.04 Intr +  16632  16813  182  2  2   57   22   203 0.587   8.34
gcattgcctacaatgtgggtggtgctccttgggctggtccctctcaccaccacccacacc
ccaccctggcatttgggtttctcttggctagaagaggtttaggccaatggcctctgcttc
atgaggggccccaagcccttgaaataagccatttctaatgggatgtgttttgattttcag
TTTGTGTTTAAGATCACTACGACCAAACAGCAGGACCACTTCTTCCAGGCAGCCTTCCTG
GAGGAGAGAGATGCCTGGGTTCGGGATATCAAGAAGGCCATTAAATGCATTGAAGGAGGC
CAGAAATTTGCCAGGAAATCTACCAGGAGGTCCATTCGACTGCCAGAAACCATTGACTTA
GG
gtgattttctgtgtttacttctctttacccattccttctgaaagacacaaacatagcaga
tcctgctccaaggcttgctttgaccacctctgatgttgtatccactctgccaggtcaata
ctggcacttggtgtactaaaatgtttacctgggtctgaaggagtgatccaaggcctacta

 1.05 Intr +  18451  18542   92  1  2   90   98    32 0.629   3.12
tgaatgttgcccctccactacttatgatctgatggagggagattaagctcaggggatacc
tggggtgggggagcttgtgctcacctcccagagagaacttaccattctgaaatgttcccc
actcatccaactgggtttttttttgtttgtttgtttgtttgcttttttatctctgtgcag
TGCCTTATATTTGTCCATGAAAGACACTGAAAAAGGAATAAAAGAACTGAATCTAGAGAA
GGACAAGAAGATTTTTAATCACTGCTTCACAG
gtaaaagcacttgcaggcctgaaatagggcgactgggaaggcgatatggagtcctccttc
ggcctcgtctgtgaggtgggggtatgaagtatgggggttggaaggggtcccagaatgcag
cctggtgagcctgaggatgaagctcctacagagtgaaaatagaaagaagtttgttgttca

 1.06 Intr +  22411  22595  185  2  2   83   41   218 0.516  15.19
gtttgtttgtttgtttctagtgggtatctatcccacttattttgttttctctttcttgaa
ataacaggggagacgagacaagtcagacctgtgggtgagctggagtcagttcaggggtga
ttgtcaggggcttgttcttcggtaaggagagttaaccttccctgtgctggtcccatctag
GTAACTGCGTCATTGATTGGCTGGTATCCAACCAGTCTGTTAGGAATCGCCAGGAAGGCC
TCATGATTGCTTCATCGCTGCTCAATGAGGGGTATCTGCAGCCTGCTGGAGACATGTCCA
AGAGTGCAGTGGATGGAACTGCTGAAAACCCTTTCCTGGACAACCCTGATGCCTTCTACT
ACTTT
gtaagaaaagctccccatctcttcttcctgtaagggaggctgccctgagcagattctaga
ttgatttcagttcatagacatctatagagcgctgttaggcagcgggtagggaggtcagcc
aggaagaacaagggaatacctgaagctcccaggcccatttagagcttctgttataccagc

 1.07 Intr +  24296  24400  105  1  0   51  109   101 0.456   7.99
aaaggaggaggagaaactcgctcatcaaggacctttgaagttcagattgggatgtacaca
ggaatggaggaaaaaggaggaggctgccctcatggctggaggggagggggaatggagatg
gcacaagttgcaatgtgcctaagactggtgatgttagcttgctgtttgattttccaacag
CCAGACAGTGGGTTCTTCTGTGAAGAGAATTCCAGTGATGATGATGTGATTCTGAAAGAA
GAATTCAGAGGGGTCATTATCAAGCAGGGATGTTTACTGAAGCAG
gtgagtggccacaactgctcccatctagccttttccctttacaaggtcctttttgtttct
aagttacccagtgacttttggtttgtttggttaatagtcaagcagaaaatgaaacccaca
aagtgaaagatagatgagtagctctttagatatcaaagtggctttagatcaggaagattg

 1.08 Intr +  30016  30085   70  0  1  104   95    47 0.124   4.84
gtggaggatctggaaggaccttagatctgtcagcagtttttctttaatctccttctgctc
ttacttattttggggggccctgatctatattagagtgagtctggctttttcaccaagagg
atgaggtctatctatactctgcattttggaaacataatgaacaactcctttcttctttag
GCAGAAGATCCCCTGGGAGCAATTCACTTGAGAGGCTGTGTGGTGACTTCAGTGGAGAGC
AACTCAAATG
gtaagatgaatttctgtgtgagagaggtgggtctgctcagactcccctcccacacctgga
catcctgggccaacattaatcaatcaatcaattaatcaggataagcaggaatggggcagg
catggtggctcccacctgtaatcccggcactttgggaggccgaggagggcagatcacttg

 1.09 Term +  31589  31725  137  0  2  127   43   159 0.938  12.50
atgtatataactgtgcaatgaattatcctataatcataccttgtttgtatgtttgaaagc
cacatagtcaatttccttagaacacgaagaaaacagagatttcatggcttgcagaggagg
gtggagcaagtggtctttctgatgcctgtgcgtgctgccatttgccttctctttccccag
GCAGGAAGAGTGAGGAAGAGAACCTTTTTGAGATCATCACAGCAGATGAAGTGCACTATT
TCTTGCAAGCAGCCACCCCCAAGGAGCGCACAGAGTGGATCAGAGCCATCCAGATGGCCT
CCCGAACTGGGAAGTAA
agagactcctgcattcctcctcccctcctgagggaagcccatggacaagctcagtccagg
acctgtccacttctgtgacaaatcaacgggaaacagcccaggggtgggaagttttcattt
gcaggggggtctgaatgtaactcaccatgtggtgtgcaaggttcccctgcattgtattgc

Predicted peptide sequence(s):


>PLEK_1|GENSCAN_predicted_peptide_1|338_aa
MEPKRIREGYLVKKSQTPEAALDLEKHNVKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSP
KGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDIKKAIKCIE
GGQKFARKSTRRSIRLPETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDW
LVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGF
FCEENSSDDDVILKEEFRGVIIKQGCLLKQAEDPLGAIHLRGCVVTSVESNSNGRKSEEE
NLFEIITADEVHYFLQAATPKERTEWIRAIQMASRTGK