GENSCAN 1.0	Date run: 15-Jan-104	Time: 21:28:05

Sequence PKP4_1 : 226131 bp : 38.63% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    626    701   76  2  1   47   64    88 0.578   0.90
acataagtaggatttaggtggctcagtgacgtcaggaggaagcagcgatggaagggatgg
ggtgcaaactcacctggagaagcagaagctgcacacatgtcaaaggtcaaagggcatagc
ctcagggactccccaaacgcaggaaaagtgaaacgcccactcctgggctctcgccgtcag
GGGTACATCTAAGGGCTCAGCTGTTCCTACCTTTGACGCCAGGGACAAACCCTACCAGGC
ACAGTTGGGATTGGCA
gtaaggcaaggaaagcctgccccagatttcagagccagcgctggggaatctccctgtcct
ctccgccaccccctcccgcgcccgagacctgagacaccttctctctcacacccaccctct
ccaggccctctcgcgctgaacagcatcggtctctatggcgacctgaaaccgcagctccca

 1.02 Intr +   1257   1322   66  2  0   50  106    90 0.846   5.18
gagtccgcgtcgacgccggccgcggaggcggcaccatgggcaaggggtagaggggcaagt
tggccaccgccgccgccgggggtggtgggagagccgctccgggggcgggggccggtgggg
gagggaggggcgggcagccgcgccgccgcggcacttttttaattttttcgggtgccgcag
CGGCGACCCCTCGGCGCCGATGTCCCTGATCCCTGGAGCGACGACGGCCGCTGCCTAAGC
TGGAAA
gtaagtgtgtgggctcgcgggagggcgcggagactcctgcccacgagaccctcggccctc
gccccgaacacgcgccagggccaggacctgcgcgccgggggccgggggcctccctcccgc
tgccgcgtccccagcgcctcgcggccgccgcggctttcctgccccgcctcgtgttcctgc

 1.03 Intr +   1457   1892  436  1  1  107   -9   118 0.496  -3.77
tgtccctgatccctggagcgacgacggccgctgcctaagctggaaagtaagtgtgtgggc
tcgcgggagggcgcggagactcctgcccacgagaccctcggccctcgccccgaacacgcg
ccagggccaggacctgcgcgccgggggccgggggcctccctcccgctgccgcgtccccag
CGCCTCGCGGCCGCCGCGGCTTTCCTGCCCCGCCTCGTGTTCCTGCCCGCACTCGCCTGC
TGCTCCCCTCCCCCCGGCAGGCGCACAAGTTTCACCCTCCATTTGCTTTTCCCGGCGATT
CCTCTCCCCGGTCTCCCGTACGCGCAGCGCACGACCTCTGCCCACGCTGGGCTGTTCGGA
TTCAGAGCTCCCAGCCCCGAACTTGAGCGCCGCGCTGAGCCCTGCTGGACGCCCTCGCGG
CGGCTTCCCCGCTGCCTGCCGCCGCGCGCCCCAAGTCGCCCTCGACACCACTGGGCGCCC
GCCCTCCTCAGCACTCGGGGCCGGCTGTCTGTCCTTCTAGCCCCAGATCCTGCACCTTGG
TCCCCTCCCCGTCTTCCCACGCCCCTGCTGCCCGCGCGGTCTTGCGTTTGTCCCCGAAGT
CCTGTACTCCTTGCCG
gtcctgcccacccctctgcctagtgcgcccctctctaccggccgcggatcctcacgctcc
acccctcccggctccccagcgccgagcctcgccgctgccctcctgcgccgccgcttcctc
ctctccctgccaggagttgaagcggagctgcggcacctccctggcggatctggtatcccc

 1.04 Intr +   2026   2234  209  2  2  108   89   150 0.635  14.97
gcccgcgcggtcttgcgtttgtccccgaagtcctgtactccttgccggtcctgcccaccc
ctctgcctagtgcgcccctctctaccggccgcggatcctcacgctccacccctcccggct
ccccagcgccgagcctcgccgctgccctcctgcgccgccgcttcctcctctccctgccag
GAGTTGAAGCGGAGCTGCGGCACCTCCCTGGCGGATCTGGTATCCCCGCCCGCTGCCGAG
GCTGCCGGCCCTCTCCCCTGGACCGCTACCCGGAGAGCGAGCGGCGGGGCCGGGATTTGG
CTGCGTGTTGGCTGAGTGCGACACACCGCGAGCGCGGGCAGTGGAGGTGCCGCGGCGGCC
GTGGCCGCTCGGGGCGCAGCGGTAGTCAG
gtgtgtgtgtacagcgggggacgcgcgctgccggctcctgggctggcgacagattgtgca
ggaatgcgaggaatgcaccaggggcagagtccacacagcccgccgcggctgccctagcgc
cttccctccccagctctcgccgcgcagccagaggtcaccggagcatcttcggagctggtg

 1.05 Intr +   2249   2411  163  1  1   -8   93    56 0.520  -4.87
ccccgcccgctgccgaggctgccggccctctcccctggaccgctacccggagagcgagcg
gcggggccgggatttggctgcgtgttggctgagtgcgacacaccgcgagcgcgggcagtg
gaggtgccgcggcggccgtggccgctcggggcgcagcggtagtcaggtgtgtgtgtacag
CGGGGGACGCGCGCTGCCGGCTCCTGGGCTGGCGACAGATTGTGCAGGAATGCGAGGAAT
GCACCAGGGGCAGAGTCCACACAGCCCGCCGCGGCTGCCCTAGCGCCTTCCCTCCCCAGC
TCTCGCCGCGCAGCCAGAGGTCACCGGAGCATCTTCGGAGCTG
gtgagcctcattccactcctctcctcccatagcttccctccatgcggcagaggggaagcg
cggtaattctttggggctccagctagcctttcgtctgggtttttgctgcattggtcttca
ggaccgtgaatttggggccgatgactgtgtagccaaggttattgatcattgcacagggct

 1.06 Intr +   2444   2604  161  0  2  113   50   115 0.322   8.99
gccggctcctgggctggcgacagattgtgcaggaatgcgaggaatgcaccaggggcagag
tccacacagcccgccgcggctgccctagcgccttccctccccagctctcgccgcgcagcc
agaggtcaccggagcatcttcggagctggtgagcctcattccactcctctcctcccatag
CTTCCCTCCATGCGGCAGAGGGGAAGCGCGGTAATTCTTTGGGGCTCCAGCTAGCCTTTC
GTCTGGGTTTTTGCTGCATTGGTCTTCAGGACCGTGAATTTGGGGCCGATGACTGTGTAG
CCAAGGTTATTGATCATTGCACAGGGCTGTTGGCAAGTTTG
gtgtgcaaggtttggatagtgcctggttttcactagggttttctgaaaaccagcagaaac
agggggcctgaaggttgttagagtaatgagcttgcagccaacatattttagctctatcaa
aaaatgcctgttagtgctcacgggcatgtactgcgagagagatcttgaatgcatcacttt

 1.07 Term +  14523  14660  138  2  0  114   31    44 0.086  -1.72
cccttctcttctaaccttcagtggctctccattgtttaccctgctggatcatattcacat
tccccagcgacctaccatataaggcccgttacagtcaaaccttaattactctccttcctg
aaccctccacatcagcaagtctagtttctactcattgttctctgtctccctccactctag
GTTCACATCTTCAAAGTCCTTCAAGACCTAGTTCAAATAGATACTGTAATAGTATCTAAC
TTTTTTGTGGTAGAAAGAAAGAAAGCGCAGAGATCCTACTCTGATGACAACAAGAACAAA
AAACACAACACAATCTAA
ttcattattttcttcaacccatcagagagttgaaatatcataaacaactaacctgaaatc
taaggaaggaaaggcatctccaaggttggacttgcttacctgggacagatgatgctggac
actagtaagaagaactgagttaaaaatgtttagcaaattgctaagtgttgaatgtgggca

 2.03 PlyA -  18107  18102    6                               1.05
 2.02 Term -  43033  42747  287  2  2   78   43   124 0.448   1.48
 2.01 Init -  46680  46659   22  0  1   54  100    44 0.467   2.13
 2.00 Prom -  50432  50393   40                              -3.05

 3.01 Sngl +  67629  68645 1017  2  0   88   43   760 0.999  68.27
cgggaggcacccccccagcaggggcacactgacacctcacacggcagggtattccaacag
acctgcagctgagggtcctgtctgttagaaggaaaactaacaaacagaaaggacatccac
accgaaaacccatctgtacatcaccatcatcaaagaccaaaagtagataaaaccacaaag
ATGGGGAAAAAACAGAACAGAAAAACTGGAAACTCTAAAACGCAGAGCACCTCTCCTCCT
CCAAAGGAACGCAGTTCCTCACCAGCAACAGAACAAAGCTGGATGGAGAATGACTTTGAC
GAGCTGAGAGAAGAAGGTTTCAGACGATCAAATTACTCTGAGCTACGGGAGGACATTCAA
ACCAAAGGCAAAGAAGTTAAAAACTTTGAAAAAAATTTAGAAGAATGTATAACTAGAATA
ACCAATACAGAGAAGTGCTTAAAGGAGCTGATGGAGCTGAAAACCAAGGCTCGAGAACTA
CGTGAAGAATGCAGAAGCCTCAGGAGCCGATGTGATCAACTGGAAGAAAGGGTATCAGCA
ACGGAAGATGAAATGAATGAAATGAAGCGAGAAGGGAAGTTTAGAGAAAAAAGAATAAAA
AGAAATGAGCAAAGCCTCCAAGAAATATGGGACTATGTGAAAAGACCATATCTACGTCTG
ATTGGTGTACCTGAAAGTGATGGGGAGAATGGAACCAAGTTGGAAAACACTCTGCAGGAT
ATTATCCAGGAGAACTTCCCCAATCTAGCAAGGCAGGCCAACGTTCAGATTCAGGAAATA
CAGAGAACGCCACAAAGATACTCCTCGAGAAGAGCAACTCCAAGACACATAATTGTCAGA
TTCACCAAAGTTGAAATGAAGGAAAAAATGTTAAGGGCAGCCAGAGAGAAAGGCCGGGTT
ACCCTCAAAGGGAAGCCCATCAGACTAACAGCAGATCTCTCGGCAGAAACCCTACAAGCC
AGAAGAGAGTGGGGGCCAATATTCAACATTCTTAAAGAAAAGAATTTTCAACCCAGAATT
TCATATCCAGCCAAACTAAGCTTCATAAGTGAAGGAGAAATAAAATACTTTACAGACAAG
CAAATGCTGAGAGATTTTGTCACCACCAGGCCAGCCCTAAAAGAGCTCCTGAAGGAAGCA
CTAAACATGGAAAGGAACAACCGGTACCAGCCGCTGCAAAATCATGCCAAAATGTAA
agagcatcgagactaggaagaaactgcatcaactaacgagcaaaatcaccagctaacatc
ataatgacaggatcaaattcacacataacaatattaactttaaatgtaaatggactaaat
tctccaattaaaagacacagactggcaagttggataaagagtcaagacccatcagtgtgc

 4.01 Init +  69135  70172 1038  2  0   44   41   480 0.280  32.93
gactttaaaccaacaaagatcaaaagagacaaagaaggccattacataatggtaaaggga
tcaattcaacaagaggagctaactatcctaaatatatatgcacccaatacaggagcaccc
agattcataaagcaagtcctgagtgacctacaaagagacttagactcccacacattaata
ATGGGAGACTTTAACACCCCACTGTCAACATTAGACAGATCAACGAGACAGAAAGTCAAC
AAGGATACCCAGGAATTGAACTCAGCTCTGCACCAAGCGGACCTAATACACATCTACAGA
ACTCTCCACCCCAAATCAACAGAATATACATTTTTTTCAGCACCACACCACACCTATTCC
AAAATTGACCACATAGTTGGAAGTAAAGCTCTCCTCAGCAAATGTAAAAGAACAGAAATT
ATAACAAACTATCTCTCAGACCACAGTGCAATCAAACTAGAACTCAGGATTAAGAATCTC
ACTCAAAGCCGCTCAACTACATGGAAACTGAACAACCTGCTCCTGAATGACTACTGGGTA
CATAACGAAATGAAGGCAGAAATAAAGATGTTCTTTGAAACCAATGAGAACAAAGACACA
ACATACCAGAATCTCTGGGACGCATTCAAAGCAGTGTGTAGAGGGAAATTTATAGCACTA
AATGCCCACAAGAGAAAGCAGGAAAGATCCAAAATTGACACCCTAACATCACAATTAAAA
GAACTAGAAAAGCAAGAGCAAACACATTCAAAAGCTAGCAGAAGGCAAGAAATAATGAAA
ATCAGAGCAGAACTGAAGGAAATAGAGACACAGAAAACCCTTCAAAAAATCAATGAATCC
AGGAGCTGGTTTTTTGAAAGGATCATCAAAATTGATAGACCGCTAGCAAGACTAATAAAG
AAAAAAAGAGAGGAGAATCAAATAGACACAATAAAAAATGATAAAGGGGATATCACCACC
GATCCCACAGAAATACAAACTACCATCAGAGAATACTACAAACACCTCTACGCAAATAAA
CTAGAAAATCTAGAAGAAATGGATAAATTCCTCGACACGTACACTCTCCCAAGACTAAAC
CAGGAAGAAGTTGAATCTCTGAATAGACCAATAACAGGAGCTGAAATTGTGGCAATAATC
AATAGTTTACCAACCAAAAAGAGTCCAGGACCAGATGGATTCACAGCCGAATTCTACCAG
AGATACAAGGAGGAACTG
gtaccattccttctgaaactattccaatgaatagaaaaagagggaatcctccctaactca
ttttatgaggccagcatcattctgataccaaagccgggcagagacacaaccaaaaaagag
aattttagaccaatatccttgatgaacattgatgcaaaaatcctcaataaaatactggca

 4.02 Intr +  70461  72291 1831  2  1  -16   60   466 0.014  19.77
accaaaaaagagaattttagaccaatatccttgatgaacattgatgcaaaaatcctcaat
aaaatactggcaaaacgaatccagcagcacatcaaaaagctaatccaccatgatcaagtg
ggcttcatccctgggatgtaaggctggttcaatatacgcaaatcaataaatgtaatccag
CATATAAACAGAGCCAAAGACAAAAACCACATGATTATCTCAATAGATGCAGAAAAAGCC
TTTGACAAAATTCAACAACCCTTCATGCTAAAAACTCTCAATAAATTAGGTATTGATGGG
ACGTATTTCAAAATAATAAGAGCTATCTATGACAAACCCACAGCCAATATCATACTGAAT
GGGCAAAAACTGGAAGCATTCCCTTTGAAAACTGGCACAAGACAGGGATGCCCTCTCTCA
CCGCTCCTATTCAACATAGTGTTGGAAGTTCTGGCCAGGGCGATCAGGCAGGAGAAGGAA
ATAAAGGGTATTCAATTAGGAAAAGAGGAAGTCAAATTGTCCCTGTTTGCAGACGACATG
ATTGTTTATCTAGAAAACCCCATTGTCTCAGCCCAAAATCTCCTTAAGCTGATAAGCAAC
TTCAGCAAAGTCTCAGGATACAAAATCAATTTACAAAAATCACAAGCATTCTTATACGCC
AACAACAGACAAACAGAGAGCCAAATCATGAGTGAACTCCCATTCACAATTGCTTCAAAG
AGAATAAAATACCTAGGAATCCAACTTACAAGGGATGTGAAGGACCTCTTCAAGGAGAAC
TACAAACCACTGCTCAAGGAAATAAAAGAGGATACAAACAAATGGAAGAACATTCCATGC
TCGTGGGTAGGAAGAATCAATATCGTGAAAATGGCCATACTGCCCAAGGTAATTTACAGA
TTCAATGCCATCCCCATCAAGCTACCAATGCCTTTCTTCACAGAATTGGAAAAAACTACT
TTAAAGTTCATATGGAACCAAAAAAGAGCCCGCATCGCCAAGTCAATCCTAAGCCAAAAG
GACAAAGCTGGAAGCATCACACTACCTGACTTCAAACTATACTACAAGGCTACAGTAACC
CAAACAGCATGGTACTGGTACCAAAACAGAGATATAGATCAATGGAACAGAACAGAGCCC
TCAGAAATAACGCTGCATACCTACAACTATCTGATCTTTGACAAACCTGAGAAAAACAAG
CAATGGGGAAAGGATTCCCTATTTAATAAATGGTGCTGGGAAAACTGGCTAGCCATATGT
AGAAAGCTGAAACTGGATCCCTTCCTTACACCTTATACAAAAATCAATTCAAGATGGATT
AAAGATTTAAACGTTAGACCTAAAACCATAAAAACCCTAGAAGAAAACCTAGGCATTACC
ATTCAGGACATAGGCGTGGGCAAGGACTTCATGTCCAAAACACCAAAAGCAATGGCAACA
GAAGCCAAAATTGACAAATGGGATCTAATTAAACTAAAGAGCTTCTGCACAGCAAAAGAA
ACTACCATCAGAGTGAACAGGCAACCTACAACATGGGAGAAAATTTTCGCAACCTACTCA
TCTGACAAAGGGCTAATATCCAGAATCTACAATGAACTCAAACAAATTTACAAGAAAAAA
ACAAACAACCCCATCAAAAAGTGGGCGAAGGACATGAACAGACACTTCTCAAAAGAAGAC
ATTTATGCAGCCAAAAAATACATGAAAAAATGCTCATCATCACTGGCCATCAGAGAAATG
CAAATCAAAACCACTATGAGATACCATCTCACACCAGTTAGAATGGCAATCATTAAAAAG
TCAGGAAACAACAGGTGCTGGAGAGGATGTGAAGAAATAGGAACACTTTTACACTGTTGG
TGGGACTGTAAACTAGTTCAACCATTGTGGAAGTCAGTGTGGCGATTCCTCAGGGATCTA
GAACTAGAAATACCATTTGACCCAGCCATCCCATTACTGGGTATATACCCAAATGACTGT
AAATCATGCTGCTATAAAGACACATGCACAC
gtatgtttattgcggcattattcacaatagcaaagacttggaaccaatccaaatgtccaa
caatgatagactggattaagaaaacgtggcacatatacaccatggaatactatgcagcca
taaaaaatgatgatttcatgtcctttgtagggacatggatgaaattggaaaccttcattc

 4.03 Intr +  77284  77420  137  2  2   64   88    94 0.051   6.37
tgataagttagtcatatttacttattggttacctgtttagaaaatttagcaatttcacaa
gtttttgatcatggtgtgtagactgtagtctactgtagttgctaggaaccatctgtaaag
ccttggttcctgcaagggagcccagaagaaagtgttaaccctttgcctgcttgattgcag
GAGGAATGCCAGCTCCTGAGCAGGCCTCATTGGTGGAGGAGGGGCAACCACAGACCCGCC
AGGAAGCTGCCTCCACTGGCCCAGGCATGGAACCCGAGACCACAGCCACCACTATTCTAG
CATCCGTGAAGGAGCAG
gtacatcctcgtattgaaagttgcagtgaattatttctttaatgcctttaaaaaattaat
ctttggatatgttttaaatttgtgtaacgtccttgacgccttcacgttttctaattataa
ggtgtttacatccctgagtacattgggatgactggcatgtagagccgctccaggtgccag

 4.04 Intr +  88228  88298   71  0  2   64   72    53 0.010  -1.64
tttctcatcactttgcggttcaggaattatgaggattatctcatttgaaatgagaggaaa
ctgaggtgtaaattgattgctaaagctgttgatagtcacacacaattcataagcaatcag
cctgaattctcctccccacccctagtccaccaccactcacagagcttgtgctcttgccag
GGCTTACTAGAGCCATGCTTAAGTGAAGCAAAATCACTTCCTAGCTTTGTGGCTCCAGGG
CAGCCAGCCAG
gtagtgtttccaagcctcagtctgcctgttagacagtggggataagagcaattagttgac
tgcctattacataggggcatcgtaagactcatgaaaataaaggttcttagaaatccaaaa
acaattttgtaaaaaggactgttataaagcattgttatggatatccttaagtcagcaaag

 4.05 Term +  92718  92841  124  0  1   44   47   185 0.104   6.88
ggaaagaaggccaaggggaagaaggtggccctggcccctgttgttgcagagaagcaggag
gccaagaaagtgatggatcccctgtttgagaaaagacctgagaattttggcattggatag
gacatctagcccaaatgggatcttaacccactttgtcaaatgcccctgctactacatcag
GTTGCAGCAGCAAAGAGCTGTCCTCTATCCAGAGCTGAAAGTGCCTCTTGCGATGAACCA
GTTCACCCCGGCCGTGGACCGCCAAGCAGCTACTCAGCTGCTTAAGCTGGCCCATAAGTA
CTGA
ccagagacaaagcaagagaagaagcagagacttggcctgggctgagaagaaagctgccag
caaagggaacatccccattaagagaccacctgtccttcgagtaggggttaacattgtcac
cacctttggagaacaagaaggctcagctggtggtgatcgcacatgacatggatcccattg

 5.01 Init + 115836 115862   27  2  0   88   90    30 0.775   2.86
tgcagtattttcgagaaagaactacatttcaattaaagcctggaagtggagagtattctt
agtaactcagaggtggagaacattctgattaaaagataaagagtttgtaaagagagagtt
tgtaaactggaatgagacttccacagggcacagttggaaagggtcaggagatatgtcact
ATGGCCATCAGTGAGGACTTAATGAGG
gtaagagactaggaggccacaggaggatgaagtatgacctgctttcagtgttacgtgaaa
atggttcaagggactgagccttgaactggagtggagctcttcctgctcatcaaaggagcg
ggagtgcagagacctaattctgaaagctacctagggtttctgaaagccagaaggaagatg

 5.02 Intr + 121375 121487  113  0  2   62   92   195 0.968  15.56
tgaaaaagctaggaatcaataggtcatttatttcatccaaaaattgcatttcacaaagcc
acaccatagctttatgttatgggtacgttcctatgtttcctgtgacatacattaattcat
atatctgcctgagcagcataccttggcgccttatatgccttttattttcttgaatcacag
GAGCTTCAGTTTCAGCGACTCACCCGAGAACTGGAAGTGGAAAGGCAGATTGTTGCCAGT
CAGCTAGAAAGATGTAGGCTTGGAGCAGAATCACCAAGCATCGCCAGCACCAG
gtacagggccaatggctccatctttatgcacactcaagttacatgccttactaggttgtt
ctctatgcagcaaaagattctgttagtgttgttactgttaacttgccttccagaatttga
aaccaaaaatgtccatttattctaattttgagaagcctcttgcaatccctcagtcctgtg

 5.03 Term + 124405 124495   91  1  1   80   47    54 0.162  -3.29
tatatgcatggctattagattatgttctggacttgtgaattttaaaatgttaaataattt
taaggctatatcgttcattggctggttccatatgtttttttaaaatctctaagtaaagta
catattgtgggtagtagtttctgtcagtgactttttttgtggttcctgtctggttctcag
TGCCTGGCATTTGTGCCTGGCAAGTGACTGTGGCACCACCAGTGAATGTCGGGTGAATGA
ATGGGTCATGCAGAAATGGGAGTGGGGTTGA
ccagggaaaggaggaaaatgtgcacaaatgcatatatggccccacaaacagttgtcccga
gcagtaagaggctcagtgtctaggatatgtcctaaaaggacctactggcttatgaaattg
gaaaggtgaagctggcatttaattgtgaagaactttattagatctttaaaggagaccaac

 6.03 PlyA - 125194 125189    6                               1.05
 6.02 Term - 128296 128074  223  0  1   -3   42   229 0.077   4.61
 6.01 Init - 138320 138178  143  2  2   72   48   135 0.615   7.56
 6.00 Prom - 140439 140400   40                              -3.65

 7.01 Init + 154981 155110  130  0  1   40   86    94 0.853   4.82
cacaatatcacagtttttctgtttgcgagaaaaaaaaattactagagtttaggtggttgc
caacttgagtagatctgtgtaaaatgcaggggaggagaatcggcctcagaatccagcctc
cctccgccccagctcttcctagcacattagaccaggagcagtccgtcttacagggctgga
ATGTGCTGCTCTGTCCCCACCAGCCAGCCAGCCAAGCTCATTCTTTTTAACACTGCTGTG
TTCCTAGAAAAAGAAAGTGTTCGAGAAATTGATGGATGTTACGTAGGTGATAAAGAATTG
GTGCTCATGG
gtaagaaattagaggccaaaaaagattggaatctctaccaaaacaacaagtgagagaaat
tttctggttgactcagaaggcactgaggggttaatagatttggatgaacaggagagaaaa
tagtaacaattctgtgcagttaggagttttgatgtttgacagtaaatatggaagggaaga

 7.02 Intr + 165094 165219  126  2  0   85   59   147 0.821  11.23
agtataagtatatggaacacattcatatagttaagagtcagatgtgctgtgtaagctgaa
aataatagccttgtattagcatatagattctaagatgctgttgacaaacatctgaacctt
ttttagcaagtttttatgtaatgttattatatttagctgattaaacttttcttgttacag
ACGTGCCAAATACTGGTGTAAGCAAACCTAGAGTTTCTGACGCTGTCCAGCCCAACAACT
ATCTCATCAGGACAGAGCCAGAACAAGGAACCCTCTATTCACCAGAACAGACATCTCTCC
ATGAAA
gtgagggtctgttgtgttatcttttaagtactggatttgcttttaagattttattcttga
aagcgagtgtcagaagtgtgtataataaagatatttcttggtttcattcttacaggatca
ttgggtaactcaagaagttcaacacaaatgaattcttattccgacagtggataccaggaa

 7.03 Intr + 165335 165525  191  0  2   90  115    92 0.990  10.48
tctcatcaggacagagccagaacaaggaaccctctattcaccagaacagacatctctcca
tgaaagtgagggtctgttgtgttatcttttaagtactggatttgcttttaagattttatt
cttgaaagcgagtgtcagaagtgtgtataataaagatatttcttggtttcattcttacag
GATCATTGGGTAACTCAAGAAGTTCAACACAAATGAATTCTTATTCCGACAGTGGATACC
AGGAAGCAGGGAGTTTCCACAACAGCCAGAACGTGAGCAAGGCAGACAACAGACAGCAGC
ATTCATTCATAGGATCAACTAACAACCATGTGGTGAGGAATTCAAGAGCTGAAGGACAAA
CACTGGTTCAG
gtaagccaaacgcatcaagatctctgcaaagaaataccttccggccgggcacagtggctc
atgcctgtaatcccagcattttgggaggccgaggcgggtggatcacctgaggtcaggagt
tcaagaccagcctgcctaacatggcgaaaccccgtctctactaaaaatacaaaaattagc

 7.04 Intr + 168982 169531  550  0  1   62   96   412 0.824  30.91
caactaaagcaccgtgaggaaaaattaatgtctggctcaaagcataaaaaggaaaagaat
cttagatgcctaaaatagtggattcacattctgtagtgagctatgtgtatttcttttgta
atggcaatgaacacaaaaccctggataaacccattctcttttttccccccctttcatcag
CCATCAGTAGCCAATCGGGCCATGAGAAGAGTTAGTTCAGTTCCATCTAGAGCACAGTCT
CCTTCTTATGTTATCAGCACAGGCGTGTCTCCTTCAAGGGGGTCTCTGAGAACTTCTCTG
GGTAGTGGATTTGGCTCTCCGTCAGTGACCGACCCCCGACCTCTGAACCCCAGTGCATAT
TCCTCCACCACATTACCTGCTGCACGGGCAGCCTCTCCGTACTCACAGAGACCCGCCTCC
CCAACAGCTATACGGCGGATTGGGTCAGTCACCTCCCGGCAGACCTCCAATCCCAACGGA
CCAACCCCTCAATACCAAACCACCGCCAGAGTGGGGTCCCCACTGACCCTGACGGATGCA
CAGACTCGAGTAGCTTCCCCATCCCAAGGCCAGGTGGGGTCGTCGTCCCCCAAACGCTCA
GGGATGACCGCCGTACCACAGCATCTGGGACCTTCACTGCAAAGGACTGTTCATGACATG
GAGCAATTCGGACAGCAGCAGTATGACATTTATGAGAGGATGGTTCCACCCAGGCCAGAC
AGCCTGACAG
gtgcgtacaaggtgacagtgctacataaaacccagtgaggaaatcttctgtgtaacttaa
gttgaaacaaagaatgaaaaggtggaaaaggctcattcgtgtttttaatctcagatttta
aactataaacttaaggttaacttgtctttcaggttctgtaattcttaatacatgaaatta

 7.05 Intr + 175857 176045  189  1  0  105   80   147 0.881  14.24
gtagagatggggtctcactctgttcccagactggtctcaaattcctgggctcaagccatt
ctcccacctctgtctcccaaagtgctgggattacaggggttaggaatttaattagggttt
atgtttttaacctcactgtgattgtctcagttcttaacgatgtaatttttgtgcctctag
GCTTACGGAGTTCCTATGCTAGTCAGCATAGTCAGCTTGGGCAAGACCTTCGTTCTGCCG
TGTCTCCCGACTTGCACATTACTCCTATATATGAGGGGAGGACCTATTACAGCCCAGTGT
ACCGCAGCCCAAACCATGGAACTGTGGAGCTCCAAGGATCGCAGACGGCGTTGTATCGCA
CAGGTTCAG
gtgggcatcaactctgtttactggtttcctgatttcataggccccacagtagaagtgttt
tattgagattgggttccctgttagaaggaaatcatgttgcccatttggttgtcagataag
cagctgtgacagcagatcaataagcaataaaacaggttcatttagtacctatttataggt

 7.06 Term + 178174 178418  245  2  2   31   43   152 0.377   0.08
tacattaaaaacttaagtaccctttttagcactaataaggtagaattttaaaatctaaaa
gtaagcgatttatataattgccaaaaaatatagtccttaaaattaaaaatgttttacctt
taattaaagtgtgatctcatggagaacatactaatctttttcaaaatgttgactttctag
TAGGTATTGGAAATCTACAAAGGACATCCAGCCAACGAAGTACCCTTACATACCAAAGAA
ATAATTATGCTCTGAACACAACAGCTACCTACGCGGAGCCCTACAGGCCTATACAATACC
GAGTGCAAGAGTGCAATTATAACAGGCTTCAGCATGCAGTGCCGGCTGATGATGGCACCA
CAAGATCCCCATCAATAGACAGCATTCAGAAGGACCCCAGGCGAGTACCAGTTAGGAGTC
TCTAG
aaggctacagtattgcaggagtcagccagttcctccattttgacttttttaagttgctaa
gtctattatactatcattatactatcattaattccatatatattaatacttccagttgta
ttccagctatataggtcattgaggttaatttcattttaaagatagattccttctttccat

 8.01 Init + 184287 184420  134  2  2   60   43    92 0.801   1.62
aaaaattccaaactcacacatgtgtgcacatttgcacacatatatagaaaaacaggaaat
gtcagcagtaatcctgaatataggatgactggtcaaatacttgtttatagttttctgtgt
ttctgtgttatactcaagagcaaccataaacattgtttcttaaaaatcctcaggcccaca
ATGTTTGTGATTTCTAGGCTGACGCCAGCCCTGTCTGTTCCCACCAGCCCTTCCTCTCCC
TTCAGGCATGACATCTCACTTCGCTACAGTGCACGTGTTTACCTGAGCCTTGCACCTGCA
GATTTCTTACATAG
gtagaaagacataaaattagaatcaggaggaggaacacgagagtggaagttacttatatt
aagaattttctttgttcccctgaatctctttctgtgcatctgtgcgtcatgatttcctta
agatcataagcatctgggcctctgcatatgttcatcagggggaaaaattatttaggtatg

 8.02 Intr + 184731 184863  133  0  1   66   77   120 0.849   8.43
catctgggcctctgcatatgttcatcagggggaaaaattatttaggtatgtattttttag
gatttttgtaacttcccatttttgtctcagctgagctttttttccttataccaagtgttt
ttttcagtgtatttttacaacatgggccttcctttctgaagccatgtttttctcatgtag
GGAGTTTGCCTGGCGTGATCCTGAGTTGCCTGAGGTCATTCACATGCTTCAGCACCAGTT
CCCATCTGTTCAGGCAAATGCAGCGGCCTACCTGCAGCACCTGTGCTTTGGTGACAACAA
AGTGAAGATGGAG
gtacaggacatggtgcctgggatgactggggaaaataatgcctttgcatttaacagccac
gtgcttctgtatttaagaaattacccagtgtaattcaagagtctttttaaagggatattt
tgataccagatactctttcacttaactatgcatttcagtatctctcaggaaaaactagga

 8.03 Intr + 186590 186784  195  1  0   84   72   184 0.104  15.09
gagccaccgcacctggcctctccttagaatgtataaaagttgtcttatttggaataaaaa
gtaacctttgaaatggtctagagatatccacatcctgtgatctctccataacggacttct
gtatgatcactgattaattgcatgttacttaggcctggtacctaatatttttcattctag
GTGTGTAGGTTAGGGGGAATCAAGCATCTGGTTGACCTTCTGGACCACAGAGTTTTGGAA
GTTCAGAAGAATGCTTGTGGTGCCCTTCGAAACCTCGTTTTTGGCAAGTCTACAGATGAA
AATAAAATAGCAATGAAGAATGTTGGTGGGATACCTGCCTTGTTGCGACTGTTGAGAAAA
TCTATTGATGCAGAA
gtaagggagcttgttacaggtaggtatagaatgtgatctcgtcctagaggaaatgttgaa
aacagtctggactgtgcccttgtatagtggcactatggaagagttggaggttccaggtaa
tagataatgagatatatatagtgctcacaactgtgaaggctgagaattatttagtctaat

 8.04 Intr + 194757 194856  100  2  1   90   35    95 0.006   3.16
gcctgcaaaatcgcagagactcgggctaacccttatattctctaaaggcactaaagatct
atcttgtcccaactggggacaaatttcagcagcaggaatggtcaccttcaactggaatat
gcaggctggggcccctgtgtgcagcctctgtgaccagcccagttccttacttccacacag
CTCCCTCCTAGGAAGCATCTTGCCCTCAGACCACCTGAGCACCCACTTCCCACTGCGCTG
AAAGCTGAGATGGTGGTGTTCCGAGCACAGCTGGACCTGA
gtgagctcccccgtgccccatgaggattatgcatctgctgtgcaggaaatcccagagaac
acaggggtgagcaaggcaggcctgtccaccacctgcagtgctctgtgccaggcagcaggg
agtgcagcaactggcctctcatgctttggggcaggaaggagaaagcctcaagccacacct

 8.05 Intr + 202235 202418  184  0  1   96   94    39 0.819   3.22
cggaggctcataccttcactcaaaactcattagaggtctattcccaccctggttgcaaat
ataggccatagattaggtttggaacagactgacttcatattaattagagctaatacgttt
attttatttctaaagccacaggatctctatttgtttgattttttaaatctccttttttag
GAGTTCTTTGGAATTTATCCTCATGTGATGCTGTAAAAATGACAATCATTCGAGATGCTC
TCTCAACCTTAACAAACACTGTGATTGTTCCACATTCTGGATGGAATAACTCTTCTTTTG
ATGATGATCATAAAATTAAATTTCAGACTTCACTAGTTCTGCGTAACACGACAGGTTGCC
TAAG
gtaaattctttatttcttctttccagttaattctgtgattaaatatgtgtcataggtaaa
ttgattttaggaggacttactttattaacatctatctaagtttccagtttttatttcaaa
atttaggccactggactttgttattctgggagaaaaacatcgtgagcacagacttgtggc

 8.06 Intr + 203109 203198   90  0  0   95   70    63 0.880   3.39
ttcattatttgcccttaacactcatcagctccattttgaccctatttcccagccttacag
taccctgggaactggaagcaagccttagggcagagtggcacagggacagagagagtgggc
tctggtctcagaccacctggcttccaggacccgtttgagcctccgtttcctcatctgtag
AATAGGGATGATAATACCACCTCAGAGCTGTGAGGGGTCAGCAGGTACTTGTGGAAGGTG
CTTAGCACAGTGTCATCGCATGAGCACTCA
gtgagtgctgtttaacatctagcatcaccaagacaggcagcctgaaagagagcaaagctt
gtgtggctggtctgcagccttctagcattgagacaggtggctatcggccctggtcagggg
gcagtgttggtggggaggtaacaagagtcaggatcccagaatgcaggccagctcctccta

 8.07 Intr + 205437 205554  118  0  1  101   86    89 0.725   9.55
aatggggagcgggccatcattgtgagcttcaggatgttaccatgcaagcccccagtgcct
cctccgacctctaagtggctgccacctgttgttcgctctctcagatccttaaggttaagt
ccacgtggctgatgagtgcatggttcatctcagcagctcctcctgtctccacccctttag
GAACCTCAGCTCCGCGGGGGAAGAAGCTCGGAAGCAAATGCGGTCCTGCGAGGGGCTGGT
AGACTCACTGTTGTATGTGATCCACACGTGTGTGAACACATCCGATTACGACAGCAAG
gtcagtgccggcctggttgcaggagggcgtggtggcaggtgaccatgatgcctggtgcca
ctatttgcatgccattggttctttctgacctgcggatcctgtcctcctcaggaggccact
ctccagatcaaagggcaagtctccaaagttacaggggcaaggacgtggcaacttaagaaa

 8.08 Intr + 206045 206380  336  1  0   90   57   136 0.463   5.49
agccatcagtatttgagtatctactgactaaaagttcctggttgaggcactgtaatcccc
ccaaactctctgccctcctggctgcagtgcagtccacagtccccacccccagcactaact
gttgttgcacctctctacaccccctcctgctgctgctgcctgtggttggtctgtccccag
CATGAGCCCCTTACCCTCTCCCTCCTGTGCCCGAGTACAGGGCATTCTGCTCATCATTTG
TCAGCTGTGACGACCATCCAGGATCCTCCTGGGGGCCGAGGAAAGTGGAAAGAACAGGAA
AGAGGGACTGAAAGTGTCAGGACTTCCAAAGCGGGCCAGTTACTTGGTGTCAGGATGGAC
TGGACTAGGAGAGGCCATTGGAAGGTGTTGGATTGTAAGGGTGAGCCTGAGAGAAAAAAG
GATGAAGAGTGCCTGGGAGAAGAGAGAGGAATGCAAGGGAACAGCCAGTTTTTGAGCCTT
ATTGAACCAGGAGATCTGCAGATGAAATTGAGAGGA
gtaagcaagttggaaagggaagcttgctagatagacaaatgctgaacttggttttagaca
ctcaaacactcagttaaatgacagttggcctcccaatcagaggtgtgatgcagtctttta
gggaacaaaagaccatgtacagaaggcaaatgtcagcagggaaagacaccgctgaacatg

 8.09 Intr + 206931 207191  261  2  0   73    6   230 0.809  10.06
gcctcaagcatttcggtcggcatgaagtcaaatcctcagcaggactgagaagggctctgc
atcctgtcatctgggtattccacaaacactctagaatcataattctctcttcagattgtt
tcaagttctcataaataaaaagtagttctttcatatttcccatttatttcctgtctgtag
TGTTCAGTACAGAAGTGTTTTGCTCTAATGTGCCGAGTTGTTTTTAATTATACGCCATGC
TGGGTTTCAGACGGTGGAGAACTGCGTGTGCACCCTGAGGAACCTGTCTATCGGCTGGAG
CTGGAGGTGCCCCAGGCCCGGTTACTGGGACTGAACGAATTGGATGACTTACTAGGAAAA
GAGTCTCCCAGCAAAGACTCTGAGCCAAGTTGCTGGGGGAAGAAGAAGAAAAAGAAAAAG
AGGACTCCGCAAGAAGATCAA
gttagcattttattttatatgagactctcaagtttaatttttctgggagtgaggaatcac
atatttggcaagaaaataaattttctgcatagctatagctgagtcccgcaaaggtgaatg
ttttcaagtattggagatcatgttcattctgcctccatttaacgtgtgctgtttgtcttt

 8.10 Intr + 207375 207548  174  2  0  113   97    79 0.998  10.51
agcattttattttatatgagactctcaagtttaatttttctgggagtgaggaatcacata
tttggcaagaaaataaattttctgcatagctatagctgagtcccgcaaaggtgaatgttt
tcaagtattggagatcatgttcattctgcctccatttaacgtgtgctgtttgtctttcag
TGGGATGGAGTTGGTCCTATCCCAGGACTGTCGAAGTCCCCCAAAGGGGTTGAGATGCTG
TGGCACCCATCGGTGGTAAAACCATATCTGACTCTTCTAGCAGAAAGTTCCAACCCAGCC
ACCTTGGAAGGCTCTGCAGGGTCTCTCCAGAACCTCTCTGCTGGCAACTGGAAG
gtaggatgacttccacttatctacacttctttccatctttgcaaactaacttgaaatgtt
atatatatatgttctgcctcagtcagatcagccctgatggtgaaagggtcacagctactt
agcttgtgtgtgaaggggttaaagggaaaaaagggagacaagcagttgctctggggatac

 8.11 Intr + 210516 210666  151  2  1   70   77   201 0.990  16.01
agcctatctttctccccaactttggttttctcttcactgacaccacagatttgatcttca
attggaaagaaaccatttaatctattagttcatcttttggaaacatcttttttaggtgac
agtaacatatgagactggaactctgttttatgttacttcctgccttatttttctcactag
TTTGCAGCATATATCCGGGCGGCCGTCCGAAAAGAAAAGGGGCTCCCCATCCTTGTGGAG
CTTCTGAGAATGGATAACGATAGAGTTGTTTCTTCCGTGGCAACAGCCTTGAGGAATATG
GCACTAGATGTTCGCAACAAGGAGCTCATAG
gtatgttctggtgacaagatgagctgtaaatgtgagagcagctacaaaattcatgaaact
cttcttttgattaataaatatatggcttgtaaaatcattaacagctgagccctagtctcc
agtttcttggcatatttgagtactcctgttttgtgaccattctttttcagcaggaggcaa

 8.12 Intr + 213823 213989  167  2  2   43   26   223 0.732  10.36
gctttccccttataatgacatttgtccttttcttctttgccatgggttttgattttttcc
cctattattgtctctttgggggttttatttttaagagattgcatgccaccagaatctgaa
caacaataacaaaaacctagtaccttctggaagtagaatttactcttttgccgttggcag
GCAAATACGCCATGCGAGACCTGGTCAACCGGCTCCCCGGCGGCAATGGCCCCAGTGTCT
TGTCTGATGAGACCATGGCAGCCATCTGCTGTGCTCTGCACGAGGTCACCAGCAAAAACA
TGGAGAACGCAAAAGCCCTGGCCGACTCAGGAGGCATAGAGAAGCTG
gtgaacataaccaaaggcaggggcgacaggcaagtctgcggcaaggaggtgcaagcagtg
ctcttattcctgagattgtcctgtgatgaggcctttgttgaggatacctttcctattgga
aaggatttatttttgcatttcttacatgccgataagctaagcagtctccagcacttacaa

 8.13 Intr + 214757 215024  268  1  1   74  115    23 0.625  -0.22
atttcaacatatgaactttggaagggacacagaccttcagaccatagcagtccctaaagc
cacaactggtcatgccaactcctggaagaattggaaatgccaggatgagaaaaatctagg
gggcaccatttcccttgtgcccttgtctctctgctccaggcctgagtgcctgttctgcag
GAACGTCTTCTTGAATCCCCAGTTCTGGAATTGAGTTTTCTGCCACATACCCAGAAAGTA
TTAAAATTACTGCTCTGCAGCAGGGCTGCTGTGTGGCCTCAGGATGTGCCCCAGGCTTGG
ATGGCGCATTTCCCTTTGCTTCTGCATGACACCTCACTGATTAAGCAGGAAGGAAGGACT
AGAGAATCAGTGGTAAAAATTGAAGGCTGCTTGTCATGGAGCTGTAGCAGTGACTATAAG
TTTGCCTTAGTATCAGATCAGAGAAATG
gtaagtaggatgcctggtgccatctcagaacagcaggacagcaacctccctgagccacag
tagcatggcagccctctcccccaaaccccctgctttgctctctccatagcgctgatttcc
ccttgctgtggaagttatgtcttcctcttatacctgactcttccattgcagagattttta

 8.14 Intr + 215658 215835  178  1  1   45   59    93 0.155   0.16
gggggtggggagggctgggaaggggagtgagtggaaccataatcacttatgctcttaaaa
tgtcgctggacagcctgcacttgtgagcagcataagaagaggctgagatgctgagccagt
gccagaacctttccatattaagaaaattgctacccagtctaatctgtttttcaaaaccag
AGATTCGGAAAGTCCTGGACCAAATCAAATTGTCTCCTAGCTCCACACACTTAACTTCTT
TCACAAGTACTTACTGCCTGCCTGCTGTGTGCCAGACGCTCTTCTCTATGCTGGGCTTGC
AGCAGCAGACAGGTCGCATGACAGCCCCACCCGAGGTAGCTTACGTTCCATGGGTGAG
gtagacgcagacaaggtgccaaacgaacagaaacgcgtggagcgtggtgggtggtgctga
ggggcagggcgcataataatgtcagggtgggtggtgggccatgctggggagaggaatgct
agtcaatgaaggccttgcagagacagtgccttttgagcacagagctggaggaggcaggga

 8.15 Intr + 217780 217864   85  1  1   85   86   119 0.899  10.30
ttccgaacctgatcgactcccaggcacacctggtccctttgtggtgtgtcctgcagtagc
ctccatccctgtggccctgagagcgatggcctgttggccactgattttcatcctgcaccc
ctctgagtggggctgaggctgtgtcacccacattcattaatatccttgctctctacctag
ATCATCTCTGAAAGTGGTGAAGGCAGCAGCCCAGGTCTTGAATACATTATGGCAATATCG
GGACCTCCGGAGCATTTATAAAAAG
gtaacctacaagaatagctctggcataattagcattcatcagagcacacactcataatca
tttattgtaatgaaatgtcattattcattttgagaggtttctttttctcttaactctgca
ggatgggtggaatcagaaccattttattacacctgtgtcgacattggagcgagaccgatt

 8.16 Intr + 217986 218103  118  2  1   78   82    -3 0.793  -2.78
cagcccaggtcttgaatacattatggcaatatcgggacctccggagcatttataaaaagg
taacctacaagaatagctctggcataattagcattcatcagagcacacactcataatcat
ttattgtaatgaaatgtcattattcattttgagaggtttctttttctcttaactctgcag
GATGGGTGGAATCAGAACCATTTTATTACACCTGTGTCGACATTGGAGCGAGACCGATTC
AAATCACATCCTTCCTTGTCTACCACCAACCAACAGATGTCACCCATCATTCAGTCAG
gtcagtgggaaaatgccactccttggcgagaacctttgtgtgacagaacattgttcccca
gccagagaagatcaaacataagctggttaagcctgtcatctccaacactacccatgcagc
agagaaccttctgtaggaatcacacaccattataaaccacaagcccactttcttcctttt

 8.17 Intr + 220842 220970  129  1  0  104   99    67 0.637   9.15
acttgcagtacttgggtctagctgctcttccactcccagcacctctgagatattttcagc
accagctgtgtgtcatttctagttactgagctttgtgtttctggagaggattttccacag
atactgatgctgatttctctttctacccctctttctctcctcctttgcctctcccttcag
TCGGCAGCACCTCTTCCTCACCAGCACTGTTAGGAATCAGAGACCCTCGCTCTGAATACG
ATAGGACCCAGCCACCTATGCAGTATTACAATAGCCAAGGGGATGCCACACATAAAGGCC
TGTACCCTG
gtaagacgccagttgggtgtgtgatacagtctcttgaaaagccgcatttccaggcgcttg
gccagtggcctgggaagtagcctgtgcttgtattgagacagtcccccagcagcaaaccat
gttccagtcattccctttcctactttggggattgttgccttttctgcttgtttaaagtaa

 8.18 Intr + 222684 222757   74  1  2   78   68    37 0.413  -1.09
taagcagcagccaggccagatccagggaccctgagctgctacctctcccagcccgcattg
gcactggggaagacaggccctgtcggggacagtgctagccctagtgcaggggagaccacc
cagcctaatggaccagagtaataagcactagttttaatttcataaaatattttcttacag
GCTCCAGCAAACCTTCACCAATTTACATCAGTTCCTATTCCTCACCAGCAAGAGAACAAA
ATAGACGGCTACAG
gtgaatttgcaatatcatttttacagaaggctgattagcagttaacacagtaaggggtcc
acgtcgattgacttcccagagctgggccaacatggcagggtcctagatgctttccctggg
gatcttcactccttggaaactcaacgtgtggtttaagcaaagcatttccacggtagcctc

 8.19 Term + 224532 224780  249  2  0   72   39   247 0.988  12.92
taaaatccttagagtccaatagtaaacgcatagtgtgcaccagaaacagcttttaacctt
aaactgcaaatattgaatattgctttaaaaatatgaagcaggaagcccacattaattttc
ctaacacatgtatttttaaaaaattgcttttatttatttgccttttcattttgtcaacag
CATCAACAGCTGTATTATAGTCAAGATGACTCCAACAGAAAGAACTTTGATGCATACAGA
TTGTATTTGCAGTCTCCTCATAGCTATGAAGATCCTTATTTTGATGACCGAGTTCACTTT
CCAGCTTCTACTGATTACTCAACACAGTATGGACTGAAATCGACCACAAATTATGTAGAC
TTTTATTCCACTAAACGACCTTCTTATAGAGCAGAACAGTACCCAGGGTCCCCAGACTCA
TGGGTGTAG
catcaagatgcccaacagaggaactctttctttctaaccttgttcagattgaggtgaaaa
gtccatcttgctgatttgatgattgaaatgtgaaagtgaagtggaaggaatgaatgaagt
gtgttttttttttcttttttgaggaattatcagggaagtgaggaaatgtttgggagagga

Predicted peptide sequence(s):


>PKP4_1|GENSCAN_predicted_peptide_1|416_aa
XGTSKGSAVPTFDARDKPYQAQLGLARRPLGADVPDPWSDDGRCLSWKRLAAAAAFLPRL
VFLPALACCSPPPGRRTSFTLHLLFPAIPLPGLPYAQRTTSAHAGLFGFRAPSPELERRA
EPCWTPSRRLPRCLPPRAPSRPRHHWAPALLSTRGRLSVLLAPDPAPWSPPRLPTPLLPA
RSCVCPRSPVLLAGVEAELRHLPGGSGIPARCRGCRPSPLDRYPESERRGRDLAACWLSA
THRERGQWRCRGGRGRSGRSGSQRGTRAAGSWAGDRLCRNARNAPGAESTQPAAAALAPS
LPSSRRAARGHRSIFGAASLHAAEGKRGNSLGLQLAFRLGFCCIGLQDREFGADDCVAKV
IDHCTGLLASLVHIFKVLQDLVQIDTVIVSNFFVVERKKAQRSYSDDNKNKKHNTI

>PKP4_1|GENSCAN_predicted_peptide_2|102_aa
MEGDREEGCAVTTISCAAESCAWLAEAELNDHQKSLTPEGKKKKKNTHNPPNAGTGSTVL
YEQTEQEFIRAEHRGVKVLEQAKTVCPINLSPLFNTAASTDI

>PKP4_1|GENSCAN_predicted_peptide_3|338_aa
MGKKQNRKTGNSKTQSTSPPPKERSSSPATEQSWMENDFDELREEGFRRSNYSELREDIQ
TKGKEVKNFEKNLEECITRITNTEKCLKELMELKTKARELREECRSLRSRCDQLEERVSA
TEDEMNEMKREGKFREKRIKRNEQSLQEIWDYVKRPYLRLIGVPESDGENGTKLENTLQD
IIQENFPNLARQANVQIQEIQRTPQRYSSRRATPRHIIVRFTKVEMKEKMLRAAREKGRV
TLKGKPIRLTADLSAETLQARREWGPIFNILKEKNFQPRISYPAKLSFISEGEIKYFTDK
QMLRDFVTTRPALKELLKEALNMERNNRYQPLQNHAKM

>PKP4_1|GENSCAN_predicted_peptide_4|1066_aa
MGDFNTPLSTLDRSTRQKVNKDTQELNSALHQADLIHIYRTLHPKSTEYTFFSAPHHTYS
KIDHIVGSKALLSKCKRTEIITNYLSDHSAIKLELRIKNLTQSRSTTWKLNNLLLNDYWV
HNEMKAEIKMFFETNENKDTTYQNLWDAFKAVCRGKFIALNAHKRKQERSKIDTLTSQLK
ELEKQEQTHSKASRRQEIMKIRAELKEIETQKTLQKINESRSWFFERIIKIDRPLARLIK
KKREENQIDTIKNDKGDITTDPTEIQTTIREYYKHLYANKLENLEEMDKFLDTYTLPRLN
QEEVESLNRPITGAEIVAIINSLPTKKSPGPDGFTAEFYQRYKEELHINRAKDKNHMIIS
IDAEKAFDKIQQPFMLKTLNKLGIDGTYFKIIRAIYDKPTANIILNGQKLEAFPLKTGTR
QGCPLSPLLFNIVLEVLARAIRQEKEIKGIQLGKEEVKLSLFADDMIVYLENPIVSAQNL
LKLISNFSKVSGYKINLQKSQAFLYANNRQTESQIMSELPFTIASKRIKYLGIQLTRDVK
DLFKENYKPLLKEIKEDTNKWKNIPCSWVGRINIVKMAILPKVIYRFNAIPIKLPMPFFT
ELEKTTLKFIWNQKRARIAKSILSQKDKAGSITLPDFKLYYKATVTQTAWYWYQNRDIDQ
WNRTEPSEITLHTYNYLIFDKPEKNKQWGKDSLFNKWCWENWLAICRKLKLDPFLTPYTK
INSRWIKDLNVRPKTIKTLEENLGITIQDIGVGKDFMSKTPKAMATEAKIDKWDLIKLKS
FCTAKETTIRVNRQPTTWEKIFATYSSDKGLISRIYNELKQIYKKKTNNPIKKWAKDMNR
HFSKEDIYAAKKYMKKCSSSLAIREMQIKTTMRYHLTPVRMAIIKKSGNNRCWRGCEEIG
TLLHCWWDCKLVQPLWKSVWRFLRDLELEIPFDPAIPLLGIYPNDCKSCCYKDTCTRGMP
APEQASLVEEGQPQTRQEAASTGPGMEPETTATTILASVKEQGLLEPCLSEAKSLPSFVA
PGQPARLQQQRAVLYPELKVPLAMNQFTPAVDRQAATQLLKLAHKY

>PKP4_1|GENSCAN_predicted_peptide_5|76_aa
MAISEDLMRELQFQRLTRELEVERQIVASQLERCRLGAESPSIASTSAWHLCLASDCGTT
SECRVNEWVMQKWEWG

>PKP4_1|GENSCAN_predicted_peptide_6|121_aa
MRLELPSTSEALRQSISTPNPTTGVTNRMSKQDGYRKADLIPHGRQKRQNHTAGPQTLGW
PRSRSLSWPRITGSPPAGHLDVRWDPSAESPWSWETECGQKGGFPLTRHVTLVGNLALNH
L

>PKP4_1|GENSCAN_predicted_peptide_7|476_aa
MCCSVPTSQPAKLILFNTAVFLEKESVREIDGCYVGDKELVLMDVPNTGVSKPRVSDAVQ
PNNYLIRTEPEQGTLYSPEQTSLHERSLGNSRSSTQMNSYSDSGYQEAGSFHNSQNVSKA
DNRQQHSFIGSTNNHVVRNSRAEGQTLVQPSVANRAMRRVSSVPSRAQSPSYVISTGVSP
SRGSLRTSLGSGFGSPSVTDPRPLNPSAYSSTTLPAARAASPYSQRPASPTAIRRIGSVT
SRQTSNPNGPTPQYQTTARVGSPLTLTDAQTRVASPSQGQVGSSSPKRSGMTAVPQHLGP
SLQRTVHDMEQFGQQQYDIYERMVPPRPDSLTGLRSSYASQHSQLGQDLRSAVSPDLHIT
PIYEGRTYYSPVYRSPNHGTVELQGSQTALYRTGSVGIGNLQRTSSQRSTLTYQRNNYAL
NTTATYAEPYRPIQYRVQECNYNRLQHAVPADDGTTRSPSIDSIQKDPRRVPVRSL

>PKP4_1|GENSCAN_predicted_peptide_8|1047_aa
MFVISRLTPALSVPTSPSSPFRHDISLRYSARVYLSLAPADFLHREFAWRDPELPEVIHM
LQHQFPSVQANAAAYLQHLCFGDNKVKMEVCRLGGIKHLVDLLDHRVLEVQKNACGALRN
LVFGKSTDENKIAMKNVGGIPALLRLLRKSIDAELPPRKHLALRPPEHPLPTALKAEMVV
FRAQLDLRVLWNLSSCDAVKMTIIRDALSTLTNTVIVPHSGWNNSSFDDDHKIKFQTSLV
LRNTTGCLRIGMIIPPQSCEGSAGTCGRCLAQCHRMSTQNLSSAGEEARKQMRSCEGLVD
SLLYVIHTCVNTSDYDSKHEPLTLSLLCPSTGHSAHHLSAVTTIQDPPGGRGKWKEQERG
TESVRTSKAGQLLGVRMDWTRRGHWKVLDCKGEPERKKDEECLGEERGMQGNSQFLSLIE
PGDLQMKLRGCSVQKCFALMCRVVFNYTPCWVSDGGELRVHPEEPVYRLELEVPQARLLG
LNELDDLLGKESPSKDSEPSCWGKKKKKKKRTPQEDQWDGVGPIPGLSKSPKGVEMLWHP
SVVKPYLTLLAESSNPATLEGSAGSLQNLSAGNWKFAAYIRAAVRKEKGLPILVELLRMD
NDRVVSSVATALRNMALDVRNKELIGKYAMRDLVNRLPGGNGPSVLSDETMAAICCALHE
VTSKNMENAKALADSGGIEKLERLLESPVLELSFLPHTQKVLKLLLCSRAAVWPQDVPQA
WMAHFPLLLHDTSLIKQEGRTRESVVKIEGCLSWSCSSDYKFALVSDQRNEIRKVLDQIK
LSPSSTHLTSFTSTYCLPAVCQTLFSMLGLQQQTGRMTAPPEVAYVPWVRSSLKVVKAAA
QVLNTLWQYRDLRSIYKKDGWNQNHFITPVSTLERDRFKSHPSLSTTNQQMSPIIQSVGS
TSSSPALLGIRDPRSEYDRTQPPMQYYNSQGDATHKGLYPGSSKPSPIYISSYSSPAREQ
NRRLQHQQLYYSQDDSNRKNFDAYRLYLQSPHSYEDPYFDDRVHFPASTDYSTQYGLKST
TNYVDFYSTKRPSYRAEQYPGSPDSWV