GENSCAN 1.0	Date run: 15-Jan-104	Time: 21:46:03

Sequence PDK1_1 : 42402 bp : 39.77% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1252   1447  196  0  1   75  109   365 0.997  34.44
ccttcccgctccgcgtcccgcccagcggcgcagggggccgggctccggctaggagggtgg
gggccgcgccggtgacagccgatccccgcccctgctgcccgccacgtccctcacgtacca
ctcggcagaggcgcggggaaacctggcgtactggctgtggcttctctagcgggactcggc
ATGAGGCTGGCGCGGCTGCTTCGCGGAGCCGCCTTGGCCGGCCCGGGCCCGGGGCTGCGC
GCCGCCGGCTTCAGCCGCAGCTTCAGCTCGGACTCGGGCTCCAGCCCGGCGTCCGAGCGC
GGCGTTCCGGGCCAGGTGGACTTCTACGCGCGCTTCTCGCCGTCCCCGCTCTCCATGAAG
CAGTTCCTGGACTTCG
gtgagtgcggcccgggaccttgggcctttttgcgcggtcccgggcggggagctgcggccg
ctgccccaggccgggtcggcgccggccagctctcgcctgaggcgcacccctcctcctcag
cgtttccgcccccagcgccttaggtgcttccttcctccctccgaagtgccggcgctggct

 1.02 Intr +   3809   3950  142  0  1   97   99    66 0.857   7.09
gttatctcatccctcgcctcccacaggcaggtgtatctttgcctcctattccctgcccca
tcgtggtgattctatccctctggccttgccggataacttcctctctatttctctcagcct
cttgccttctgtttccttatggcttttacttactgctttacccatcatgtttggtttcag
GATCAGTGAATGCTTGTGAAAAGACCTCATTTATGTTTCTGCGGCAAGAGTTGCCTGTCA
GACTGGCAAATATAATGAAAGAAATAAGTCTCCTTCCAGATAATCTTCTCAGGACACCAT
CCGTTCAATTGGTACAAAGCTG
gtaagattctcatcttgtgtttgcaatttgatggagttgtggactttattcaaggttaca
gcaaatgcttttttttactctttggtggaatcttttttgttttgttttgttttgtttgag
acggagtcttgctctgtcgcccaggctggagtgcagtggcgcgatcttgcctcactgcaa

 1.03 Intr +   7321   7392   72  1  0   74   80    54 0.350   0.80
tcattcccagcactttgcttgaatgtgcatgggtgtaaaaattatacttcaaccataatt
tatagcagtattctaaattaaaaattataaaatgctaaaaatagcttttgagctaatttt
catgatattgaactttcagaatataaaagaacaaacttatcctattgatctgcattttag
GTATATCCAGAGTCTTCAGGAGCTTCTTGATTTTAAGGACAAAAGTGCTGAGGATGCTAA
AGCTATTTATGA
gtaagttcactattttgaccctattcttaaacctattattaggtcacttgggggaaattg
gttaacttttaggtttctactactttagaacatgtgatatatgtgactgtagcagcccat
acaggcaggacaaataacaatcagcaaatttgactaggcataagaaatgcttcgtgttcc

 1.04 Intr +   9604   9788  185  1  2  -12   93   184 0.486   7.41
tcatagatttggtatattttatgatctgaaatacatttaaataagtataggaaaacatga
accgattttccttttattaaattggggattttttgtctagcatagttggttaagcttata
tttttgtattaagtttacttgtcaaaatatttggctgttttgacagatgggtttgtttag
CTTTACAGATACTGTGATACGGATCAGAAACCGACACAATGATGTCATTCCCACAATGGC
CCAGGGTGTGATTGAATACAAGGAGAGCTTTGGGGTGGATCCTGTCACCAGCCAGAATGT
TCAGTACTTTTTGGATCGATTCTACATGAGTCGCATTTCAATTAGAATGTTACTCAATCA
GCACT
gtaagtgtccctcatgagtcaagagaagaagctaaatgagatgtgttggcatattttaaa
tttatttaggaaagttccatttaggtaggaaatttagttttaccttttggctaattaaga
aaaataaatagactgccatcaagaaaggtgtttttattgaatgtaaaatactatgtttat

 1.05 Intr +  10079  10174   96  0  0   39   94   101 0.929   4.86
ctaattaagaaaaataaatagactgccatcaagaaaggtgtttttattgaatgtaaaata
ctatgtttatcctaaaggaaaatatttgttctgtttggtacaatttaaacagtattcaga
tttggaaaagagcattaggtggtttagcttattttgttggtttttttcctttttggatag
CTTTATTGTTTGGTGGAAAAGGCAAAGGAAGTCCATCTCATCGAAAACACATTGGAAGCA
TAAATCCAAACTGCAATGTACTTGAAGTTATTAAAG
gtaaatactgacatttctccttgcaaaaaaagatacaaaaatcaaaattattgttatttc
ttactattaaaacatctatttgtatcatgagataaaatggtaggcacaaatgcatgggtt
tgaaaataaccttatagtattatttgtgcattatgtataggatgactattttattgatag

 1.06 Intr +  11957  12034   78  0  0   46  103    58 0.696   1.70
ggagaccatgtctctaccaaaaaaaaaaaaaaaaaaagcagactttcaccaaactatcaa
agtatattttcttctgtagagagttcaagactttgatttgtcaataccattgccatctta
atgcgtgaaagagaagtatatttattaaatccttttttgttttgttttgattcacactag
ATGGCTATGAAAATGCTAGGCGTCTGTGTGATTTGTATTATATTAACTCTCCCGAACTAG
AACTTGAAGAACTAAATG
gtaagcctgatgttgtctttttctcaataattagtgctttgattacttgataagggataa
gaatttaaatgttttaatggaagatgactttttatcaacttcgttggatatgaaggctaa
aggatagtaatcatgtaaaaaatatatctataaacatatgtaatttagtcagattcttta

 1.07 Intr +  13842  13918   77  1  2   87   76    10 0.541  -1.98
taaatatttgtgggtatgggttcaaacactaatacattgaagaaatggtgtggcagttct
cccccaggtaatactgtcctccgtagttaatgttttcttttcatcactacacagtttatt
cttaaaaatgctttaagcacatctctctgtactttcatatttttctcttctgctctgtag
CAAAATCACCAGGACAGCCAATACAAGTGGTTTATGTACCATCCCATCTCTATCACATGG
TGTTTGAACTTTTCAAG
gtttgtaaaatagtattacataacctttaccagtacttttctgaggttaggaatctgctc
tgaaagccaaatattccactaggttctcctattaagaagtgccatttcacatcagtatca
tatcacattgctggagatcagctttttatcaacacagggagacatctccatgtagtggtg

 1.08 Intr +  15827  15925   99  1  0   59   94    55 0.618   2.59
tcaaatcccccccaaattgactccattaaaaaaaaaactttaaatgtggttataagaatt
gtgattctttggcatatttccatcaaattttaaaacttcaaatagtgcatatgtacttga
aaattacactttctcttttctaaaaagctgtatttttaatacaaccctaatgtatttcag
AATGCAATGAGAGCCACTATGGAACACCATGCCAACAGAGGTGTTTACCCCCCTATTCAA
GTTCATGTCACGCTGGGTAATGAGGATTTGACTGTGAAG
gtaaatgtgtttaatggtttgttttcttttttttttttttgtaattgatgaacagacatg
caaaggtaaccatacgcataatttctaaaagacataatctactctcaggggaaaagaatc
ttgtctgtaatagataataagcacattgcttcattgagctggtggattatagttatccct

 1.09 Intr +  32238  32379  142  2  1   -4  117   157 0.712   8.41
cccacaaaaagtatgttgccaaaattttgtctgtaattctagaagaactctattcttcta
ggcttggaaacttctctgacatttccagtagagttatgctgtaacatgatgggggtatag
tacaagatagatctattttagaccccttcctaggaagttactaggactttattctgatag
TTTTGTGTCCGGAATTGGTGGGTTTTTGGTCTTGCTGACTTCAAGAATGAAGCTGCGGAC
CCTCGCAGTGTTACAGTTCTTAAAGATGGTGTATCCAGAGTTACTTCAGATGTTCAGATG
TGTCTGGAGTTTCTTCCTCCCG
gtgagttcctggttttgctggcttcaggagtgaagctgcagaccttcacggagagtgtta
cagctcataaaggcagggcgtctggagttgtttgttcctctcagtgggttcgtggtcttg
ctggcttcaggagtgaagctgcagacctttgtggtgagtgttgcagctcataaaggtggc

 1.10 Intr +  32407  32532  126  2  0   66   89   120 0.745   9.63
tattctgatagttttgtgtccggaattggtgggtttttggtcttgctgacttcaagaatg
aagctgcggaccctcgcagtgttacagttcttaaagatggtgtatccagagttacttcag
atgttcagatgtgtctggagtttcttcctcccggtgagttcctggttttgctggcttcag
GAGTGAAGCTGCAGACCTTCACGGAGAGTGTTACAGCTCATAAAGGCAGGGCGTCTGGAG
TTGTTTGTTCCTCTCAGTGGGTTCGTGGTCTTGCTGGCTTCAGGAGTGAAGCTGCAGACC
TTTGTG
gtgagtgttgcagctcataaaggtggcacgtccagagttgtttgttcttctgggtgggtt
cgtggtctcggtggcttcaggagtgaagctgcagaccttcgcggtgagtgttacagctca
taaaggtagtgtggacccaaagagtgagcagcagcaagatttattgtgaagagcaaaaga

 1.11 Intr +  35566  35691  126  2  0   55   89    74 0.750   3.93
tccggaattggtttcttctggtaggttcttggtcttgctgactttgagaatgaagctgcg
gaccctcatggtgagtgttacagtttttaaagatggtgtgtctggagtttgttccttcag
atgtttagatgtgtccagagtttctttcttcggtgggtttgtggtcttgcttgacctcag
GAGTGAAGCCACAGACCTTCGCAGTGAGTGTTACAGCTCTTAAAGGTGGCATGTCTGGAG
TTGTTTGTTCCTCCTGGTGGGTTCATGGTCTCGCTGACTTCAGGAGTGAAGCTGCAGACC
TTCGTG
gtgagtgttacggctcataaagatagtgcagacccaaagagtgagcagcagtaagattta
ttgtgaagagtgaaagaacaaagtttccgcagtgtggaaggggacccgagcgggttgcca
ctgctggctggggtggccagcttttattcccttatttggccccacccatgtcctgctgat

 1.12 Intr +  37660  37796  137  2  2   65  -20    92 0.468  -4.53
ctttctctctctctctgactccctctttgtccctgtctcttcctctctctgtctctgact
ttgtctctttctttctttctctctgactccctctttgtctctctcttcctctgtctctct
ctctgactttctgtctctttctctctttcctttctgctggtctttccctgcctctgccag
CTGCTTATGCTGCTCTTCTCCCCTCTCCTGGAGAAGTCCGCAGACCAAGAACCCACTGGA
AGGAACCAATTCCAGACACAATACGACCGAGCAGGCCAGCAAGGAAAAGCAATATGCTTT
TTCGAGACCAACCACAA
gtcattttatagaaagaataaagagttttaaatgaccagagggaagtcagctgatacagt
actcaagtaaacctcagcttaatcattgtcaatgcttaaatattaattatattaaatata
atgcatctctcagatgcgggctctgatagccccgtggtactcaatggcatctatcttaat

 1.13 Intr +  38036  38149  114  1  0   52   85   148 0.571  10.62
tactcaagtaaacctcagcttaatcattgtcaatgcttaaatattaattatattaaatat
aatgcatctctcagatgcgggctctgatagccccgtggtactcaatggcatctatcttaa
ttagaaaagtatttcagtgtgtgtctttctgaatagaattttgtttttctcatcaaacag
GCTGGTTTTGGTTATGGATTGCCCATATCACGTCTTTACGCACAATACTTCCAAGGAGAC
CTGAAGCTGTATTCCCTAGAGGGTTACGGGACAGATGCAGTTATCTACATTAAG
gtaatagctgtagtcttcttgatttaatatttcttttgatgataagaacagatgtccata
cttaactgtaatgaaatttaactctaccacatgctgtttaaatagaaaaaaactatggtt
ttttgctggggatctcacccattttgatagatgatcccctaaaactatggggaaagagat

 1.14 Term +  40930  41070  141  0  0   85   42    64 0.563  -1.55
taaataacacgtttcaaatatacataccatttaaaagtatatttaggtggtataaggatt
aataagatactaatagaatattatttaatttgtcgtaacctttttgccattgtctatttt
ctcaaataatgaattctaaaaaatgccagacttaataggtcttaggtttttctttttcag
GCTCTGTCAACAGACTCAATAGAAAGACTCCCAGTGTATAACAAAGCTGCCTGGAAGCAT
TACAACACCAACCACGAGGCTGATGACTGGTGCGTCCCCAGCAGAGAACCCAAAGACATG
ACGACGTTCCGCAGTGCCTAG
acacacttgggacatcggaaaatccaaatgtggcttttgtattaaatttggaaggtatgg
tgttcagaactatattataccaagtactttatttatcgttttcacaaaactatttgagta
gaataaatggaaactgaattccatttgtgcccgttaaacctcctaaaggatgaaattgca

Predicted peptide sequence(s):


>PDK1_1|GENSCAN_predicted_peptide_1|576_aa
MRLARLLRGAALAGPGPGLRAAGFSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMK
QFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQE
LLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYF
LDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLC
DLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPP
IQVHVTLGNEDLTVKFCVRNWWVFGLADFKNEAADPRSVTVLKDGVSRVTSDVQMCLEFL
PPGVKLQTFTESVTAHKGRASGVVCSSQWVRGLAGFRSEAADLCGVKPQTFAVSVTALKG
GMSGVVCSSWWVHGLADFRSEAADLRAAYAALLPSPGEVRRPRTHWKEPIPDTIRPSRPA
RKSNMLFRDQPQAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERL
PVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA