GENSCAN 1.0	Date run: 15-Jan-104	Time: 21:17:18

Sequence ODC1_1 : 10345 bp : 48.56% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    615    860  246  1  0  103   13   107 0.097   2.13
agtccctggcttcacaggggaaactacctccgcaggccaggacccatctagttacaggat
acctcgatgttacaaagacgaggcttccagcgcgggggcgtggaggcggctgccagccct
gcccgcagcgtgctggcgacccccgggacgccccttccctcccgcgcctctgctccctag
CTGGTGGGAGCAGAGCGGCACCGGGATCACTTCCAGGTCCCTTGCACCGGAGGAATGGGC
GGCAGCAGGGTCCGGAGTCGGCCCGGCGGGGCCCACGTGGCCAGCACATCGGTCCTCCGC
TCGCGATTTCCCTTTTCCGCTCTCGGGCACGAGGTACTGAACGCCAGGTGGAAGCACAGC
TGTGCAGCTACAGGCTCTGCCGTTCAGCTGCCGCGGGCCGGGGCCGGGGCCTGCGGCGTC
GTGCGC
gtgcgcggaccagttccaggcgggcgagaccgccgcagggcggggcggggcgaggcggcc
gcagggcggggagggcggggagaggcggccgcagggcggggagggcggggcgcgaagccg
ggggcgggggccacgcgtggggcaggcggtgctcggctcggctgacgtcggcccgccggc

 1.02 Intr +   1635   1766  132  1  0  108   61     6 0.126   0.52
gccggggcgggctgcgggccccgggccccgggcacgtgtgcggcgcgcctcgccggcctg
cggagacacgtggtcgccgagcgggccacgaccttgaggcgccgcttcctcccggcccgg
ggttctcccgcggctggataagggtgatccgggcgcctcgttctgcccccgtcttcacag
CTCGGGGCTGGAGGGGCCTAGGGGAGACCCACCCGGAGACCCTGCGGCCCCGCGCCGGCC
TCTTTCCCAACCCTTCGGCGGCCGCGCGCTGGCCGGGGAGCCGTTGGGGAGGCCCTGGCG
GCCGCGCAGCAG
gtgcaggggcgcagagcccgggctcgccttggtacagacgagcgggccccggccttggcg
ccttcagtttccttccagtttttattttcgctgtgtctacagagcagatgacaccaattt
ggaaacccgcgagagtgggtagagctaagatagtcttgctgtagtagctgtgatattaga

 1.03 Intr +   4479   4597  119  1  2   84   84   195 0.768  18.88
atttggaattcctggagagttgcctttgtgagaagctggaaatatttctttcaattccat
ctcttagttttccatgtaagtattcagtttacatttatgttgcaggttaatcttaagaat
tgtattgctaaggcttctaagtgaatttctccactctatttgcattttgttgcatttcag
AGGAACATCAAGAAATCATGAACAACTTTGGTAATGAAGAGTTTGACTGCCACTTCCTCG
ATGAAGGTTTTACTGCCAAGGACATTCTGGACCAGAAAATTAATGAAGTTTCTTCTTCT
gtaagtatatgaggcccatgctggcagtgcagctgagagtgccaggcaagtggaaaactt
tggcaaggtctaaggaagagcaatgaggcttacatgtcttgttatggaatgtagaaatta
attcactggtggtaaattaatagtgataatggtgatactcatatcagtggctagactcaa

 1.04 Intr +   4881   5054  174  2  0   97  121   155 0.999  19.84
atggaatgtagaaattaattcactggtggtaaattaatagtgataatggtgatactcata
tcagtggctagactcaaaagagcaggattcattgtgactgatgggaatgaaggtcgctgg
ctattggtgtggtgtgtggtgaggctgctagtgagtcacctgtgaccactcttgtttcag
GATGATAAGGATGCCTTCTATGTGGCAGACCTGGGAGACATTCTAAAGAAACATCTGAGG
TGGTTAAAAGCTCTCCCTCGTGTCACCCCCTTTTATGCAGTCAAATGTAATGATAGCAAA
GCCATCGTGAAGACCCTTGCTGCTACCGGGACAGGATTTGACTGTGCTAGCAAG
gtaagcgatagcagcaggcctcaaaagcgttgtataaaatgggcctggtattccccacga
ggcagatacaagttgtgttttttgggcaataaatgctcactaaaggcaaatggggcgggg
gggtacatgacaacttcccatgcttttctgtttattccacgtgttaagccacatatggat

 1.05 Intr +   5261   5433  173  1  2   82   87    48 0.998   2.84
gcgttgtataaaatgggcctggtattccccacgaggcagatacaagttgtgttttttggg
caataaatgctcactaaaggcaaatggggcgggggggtacatgacaacttcccatgcttt
tctgtttattccacgtgttaagccacatatggatagcatgacaccactcttctttttcag
ACTGAAATACAGTTGGTGCAGAGTCTGGGGGTGCCTCCAGAGAGGATTATCTATGCAAAT
CCTTGTAAACAAGTATCTCAAATTAAGTATGCTGCTAATAATGGAGTCCAGATGATGACT
TTTGATAGTGAAGTTGAGTTGATGAAAGTTGCCAGAGCACATCCCAAAGCAAA
gtgagttattcccccatctgagggcaagatcgggagcataagatatgtggattcttatca
aacaaacttaaatttctgattattatatttctatactttagtagaaagtagttgaaaccc
ccattgagtcatgaagcctgggactcaaactacagaatatatcagcgacagtatttagaa

 1.06 Intr +   5692   5826  135  1  0   80   94   113 0.997  10.78
attattatatttctatactttagtagaaagtagttgaaacccccattgagtcatgaagcc
tgggactcaaactacagaatatatcagcgacagtatttagaacaggattgtttttatttt
aattgtggctataagtgaacatctatcatgagacatttgctgcactttccttgcttgtag
GTTGGTTTTGCGGATTGCCACTGATGATTCCAAAGCAGTCTGTCGTCTCAGTGTGAAATT
CGGTGCCACGCTCAGAACCAGCAGGCTCCTTTTGGAACGGGCGAAAGAGCTAAATATCGA
TGTTGTTGGTGTCAG
gtgagattttggtgggatagctagaggtcaagacattgaacagtttgagttttacaggct
ttctcctagtgtttgctattattttaagaaatactaagacacagtgtctcgtctctttat
tttaccccagcttccatgtaggaagcggctgtaccgatcctgagaccttcgtgcaggcaa

 1.07 Intr +   5957   6038   82  2  1   74   84   103 0.994   8.14
ctccttttggaacgggcgaaagagctaaatatcgatgttgttggtgtcaggtgagatttt
ggtgggatagctagaggtcaagacattgaacagtttgagttttacaggctttctcctagt
gtttgctattattttaagaaatactaagacacagtgtctcgtctctttattttaccccag
CTTCCATGTAGGAAGCGGCTGTACCGATCCTGAGACCTTCGTGCAGGCAATCTCTGATGC
CCGCTGTGTTTTTGACATGGGG
gtgagtatacgtgaccctgttagggaagggcgggacacaactgacaataactagtcttaa
ttctagagttaactttttatggcagttggttctgtattacatgggtttcagcctatctgc
tgcatacatttttgttattagctgtggatctggctgacttattttcttgattctaggctg

 1.08 Intr +   6215   6298   84  1  0   80   76    50 0.890   3.02
gggggtgagtatacgtgaccctgttagggaagggcgggacacaactgacaataactagtc
ttaattctagagttaactttttatggcagttggttctgtattacatgggtttcagcctat
ctgctgcatacatttttgttattagctgtggatctggctgacttattttcttgattctag
GCTGAGGTTGGTTTCAGCATGTATCTGCTTGATATTGGCGGTGGCTTTCCTGGATCTGAG
GATGTGAAACTTAAATTTGAAGAG
gtaatttagaacaaaactgtaatactcagtagccgttctaataaattcctttttggaata
tttcaaaatttaagtgtcttaactaataccacaatgggctgaagtgtcttggtgtgatat
tttgagtgatttctttgtgctgtctgacattacacttgataccatttggttttctaaagt

 1.09 Intr +   7354   7516  163  0  1   81   80    56 0.995   3.65
gatatgtagcctggttttcagggagatgttgatgtttttttgcttttgttactttaatga
taaacctgtctgttgatgcctggtctcatgatgtcatgtcacaaggccctgtgatgttac
tcccccatgtgaatttcccacaatgaaggctgctctttcttttctgtttcactctcttag
ATCACCGGCGTAATCAACCCAGCGTTGGACAAATACTTTCCGTCAGACTCTGGAGTGAGA
ATCATAGCTGAGCCCGGCAGATACTATGTTGCATCAGCTTTCACGCTTGCAGTTAATATC
ATTGCCAAGAAAATTGTATTAAAGGAACAGACGGGCTCTGATG
gtatgtataaaggacgaatcacttcatgtataactgaaagctgatgcaaaaagtcattaa
gattgttgatctgcctttctagacgaagatgagtcgagtgagcagacctttatgtattat
gtgaatgatggcgtctatggatcatttaattgcatactctatgaccacgcacatgtaaag

 1.10 Intr +   7599   7711  113  1  2   64   86    67 0.994   4.20
agctgagcccggcagatactatgttgcatcagctttcacgcttgcagttaatatcattgc
caagaaaattgtattaaaggaacagacgggctctgatggtatgtataaaggacgaatcac
ttcatgtataactgaaagctgatgcaaaaagtcattaagattgttgatctgcctttctag
ACGAAGATGAGTCGAGTGAGCAGACCTTTATGTATTATGTGAATGATGGCGTCTATGGAT
CATTTAATTGCATACTCTATGACCACGCACATGTAAAGCCCCTTCTGCAAAAG
gtaatttctgagcatactgtataaaacaattaagaggactggtcacaacacgtgtaatta
agtagtacttcctctctccgtctctttatatagagacctaaaccagatgagaagtattat
tcatccagcatatggggaccaacatgtgatggcctcgatcggattgttgagcgctgtgac

 1.11 Intr +   7805   8019  215  1  2   66  103   204 0.959  17.21
tttatgtattatgtgaatgatggcgtctatggatcatttaattgcatactctatgaccac
gcacatgtaaagccccttctgcaaaaggtaatttctgagcatactgtataaaacaattaa
gaggactggtcacaacacgtgtaattaagtagtacttcctctctccgtctctttatatag
AGACCTAAACCAGATGAGAAGTATTATTCATCCAGCATATGGGGACCAACATGTGATGGC
CTCGATCGGATTGTTGAGCGCTGTGACCTGCCTGAAATGCATGTGGGTGATTGGATGCTC
TTTGAAAACATGGGCGCTTACACTGTTGCTGCTGCCTCTACGTTCAATGGCTTCCAGAGG
CCGACGATCTACTATGTGATGTCAGGGCCTGCGTG
gtaagtaagccatgcatgttgatggtgctgccaagaataggcaccttcttggatgtgtgc
ttcttgtctagacgaataagaaattgtcttgcctaagattaaatatatatggatattttt
cctaagaaaagttttagaaaagactgatgagtgtatttctatgtaattggaatatattta

 1.12 Term +   8660   8804  145  2  1  112   37    50 0.899  -0.32
ggaggttgaggctgcggtgagctatgatagcaccattgtattccagcctgagtaacagag
aaagaccctgtctcagaaaaaaaaaaaatacattgaattgtttcctgatgggaagtaaat
actctcatgcccagttaggagtgagtcagggtttttaatatgccactttttctttctcag
GCAACTCATGCAGCAATTCCAGAACCCCGACTTCCCACCCGAAGTAGAGGAACAGGATGC
CAGCACCCTGCCTGTGTCTTGTGCCTGGGAGAGTGGGATGAAACGCCACAGAGCAGCCTG
TGCTTCGGCTAGTATTAATGTGTAG
atagcactctggtagctgttaactgcaagtttagcttgaattaagggatttggggggacc
atgtaacttaattactgctagttttgaaatgtctttgtaagagtagggtcgccatgatgc
agccatatggaagactaggatatgggtcacacttatctgtgttcctatggaaactatttg

Predicted peptide sequence(s):


>ODC1_1|GENSCAN_predicted_peptide_1|593_aa
XGGSRAAPGSLPGPLHRRNGRQQGPESARRGPRGQHIGPPLAISLFRSRARGTERQVEAQ
LCSYRLCRSAAAGRGRGLRRRAPRGWRGLGETHPETLRPRAGLFPNPSAAARWPGSRWGG
PGGRAAEEHQEIMNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDI
LKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERI
IYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSV
KFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFS
MYLLDIGGGFPGSEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAV
NIIAKKIVLKEQTGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDE
KYYSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYV
MSGPAWQLMQQFQNPDFPPEVEEQDASTLPVSCAWESGMKRHRAACASASINV