GENSCAN 1.0	Date run: 15-Jan-104	Time: 21:25:43

Sequence NR4A2_1 : 10649 bp : 47.95% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   3703   4566  864  0  0   89  105  1141 0.926 110.49
tctttccacgccctaaactgttgttctgcagcattctctctctcctgcctttcctctcgc
gcccctacatgctctctgactgccgcgggctgccggtgtagctccaggtgtacccgagcc
cgggagaaagtgttcagttgaccaggctgagtgtgttatcaccctgtttcatttccagcc
ATGCCTTGTGTTCAGGCGCAGTATGGGTCCTCGCCTCAAGGAGCCAGCCCCGCTTCTCAG
AGCTACAGTTACCACTCTTCGGGAGAATACAGCTCCGATTTCTTAACTCCAGAGTTTGTC
AAGTTTAGCATGGACCTCACCAACACTGAAATCACTGCCACCACTTCTCTCCCCAGCTTC
AGTACCTTTATGGACAACTACAGCACAGGCTACGACGTCAAGCCACCTTGCTTGTACCAA
ATGCCCCTGTCCGGACAGCAGTCCTCCATTAAGGTAGAAGACATTCAGATGCACAACTAC
CAGCAACACAGCCACCTGCCCCCCCAGTCTGAGGAGATGATGCCGCACTCCGGGTCGGTT
TACTACAAGCCCTCCTCGCCCCCGACGCCCACCACCCCGGGCTTCCAGGTGCAGCACAGC
CCCATGTGGGACGACCCGGGATCTCTCCACAACTTCCACCAGAACTACGTGGCCACTACG
CACATGATCGAGCAGAGGAAAACGCCAGTCTCCCGCCTCTCCCTCTTCTCCTTTAAGCAA
TCGCCCCCTGGCACCCCGGTGTCTAGTTGCCAGATGCGCTTCGACGGGCCCCTGCACGTC
CCCATGAACCCGGAGCCCGCCGGCAGCCACCACGTGGTGGACGGGCAGACCTTCGCTGTG
CCCAACCCCATTCGCAAGCCCGCGTCCATGGGCTTCCCGGGCCTGCAGATCGGCCACGCG
TCTCAGCTGCTCGACACGCAGGTGCCCTCACCGCCGTCGCGGGGCTCCCCCTCCAACGAG
GGGCTGTGCGCTGTGTGTGGGGACAACGCGGCCTGCCAACACTACGGCGTGCGCACCTGT
GAGGGCTGCAAAGGCTTCTTTAAG
gtgagcaatggcgggagcggagtaggcaggtagggagcccctagtgcccgggacctcgga
gtgtgccctctgccttggtgccagtagcccagccccagctctcccgggactgcccagctc
tccggggtccgccgaagctgccctgcaggagaccatgggctgcggcggggacttccgggt

 1.02 Intr +   5356   5485  130  0  1   85  102   119 0.999  13.27
gggaggaaaaaagaaaagaaagaaagaaaaggaagagaaaaaaataaaatggaattgtgt
gtatgtgtttgtttgtggggaggaatcgtagaccccagtcacataacagaaattttctcc
gagttgcctgattttcaaaagaagaaaaaaaatgttggtctatattgtctccttttgcag
CGCACAGTGCAAAAAAATGCAAAATACGTGTGTTTAGCAAATAAAAACTGCCCAGTGGAC
AAGCGTCGCCGGAATCGCTGTCAGTACTGCCGATTTCAGAAGTGCCTGGCTGTTGGGATG
GTCAAAGAAG
gtaggctgaggggagctgccgaccctccagtttgcgcctttaggaaaccactgctcatac
tccagcatcacgttccacttcccggtgctggggatctccgactccccctcagtatggcct
ccaggaccctgcagctgcctgcttgcccggccttccctagagaaagccgccaggcccttc

 1.03 Intr +   5875   6038  164  2  2   44   90    84 0.792   3.89
gaagacataaaataaccccgcattttttaatgcttctagtcagtgaaggctttacaagca
ctggggccctcagccgctcagcctggtgccccgcggctgcggccttccccggggagggac
cgaggcagcagctgggcctgggctcggaaaagcggcgctaacagggctcttcctttgcag
TGGTTCGCACAGACAGTTTAAAAGGCCGGAGAGGTCGTTTGCCCTCGAAACCGAAGAGCC
CACAGGAGCCCTCTCCCCCTTCGCCCCCGGTGAGTCTGATCAGTGCCCTCGTCAGGGCCC
ATGTCGACTCCAACCCGGCTATGACCAGCCTGGACTATTCCAGG
gtaagaagctggcgggggggatatcatgtggacaaaccgacagatgggcaggacccctcc
ccacatccgtcattaactctcagattcaacgggggtaaagaaggcaagcaaggctgtata
tgcctcgcagctctggccagggcctcaagattcagatcttcagacaatccatgtagctgg

 1.04 Intr +   6969   7171  203  2  2   13   90   198 0.506  10.58
gacctcgtagcaccatccctaattgaattaattgccccggaacatctaatttccttactg
gtcagagagaggtttaattgttataaaaacctggctcccctattagaaacggggttagca
atttcacgggttatatattttagagaacctcattaagtgctttttaaaatgaaattccag
TTCCAGGCGAACCCTGACTATCAAATGAGTGGAGATGACACCCAGCATATCCAGCAATTC
TATGATCTCCTGACTGGCTCCATGGAGATCATCCGGGGCTGGGCAGAGAAGATCCCTGGC
TTCGCAGACCTGCCCAAAGCCGACCAAGACCTGCTTTTTGAATCAGCTTTCTTAGAACTG
TTTGTCCTTCGATTAGCATACAG
gtaataagggagggagggagacaatccagggaggctgtgagagaaatcaagaaaggaaaa
gaaagggaggaagggaaaccagagggtggggtagagaaaaagacagaataggaaatggaa
gtcggagaaaggaagaaaaagaaagaaaacaaaaaaagacgagaagaagcgagcccagaa

 1.05 Intr +   7561   7739  179  1  2   96   82   121 0.884  11.86
agggggcgttcttgattgttatgaaattaaaccctttcaaggtccactggtctacatttt
attaactcttcagtaattaggtgactcttaaatccctcatttattgctcttcaagtaatt
agttgtttagcttttctctctctctttttctcccctctctctctttggtattaattgcag
GTCCAACCCAGTGGAGGGTAAACTCATCTTTTGCAATGGGGTGGTCTTGCACAGGTTGCA
ATGCGTTCGTGGCTTTGGGGAATGGATTGATTCCATTGTTGAATTCTCCTCCAACTTGCA
GAATATGAACATCGACATTTCTGCCTTCTCCTGCATTGCTGCCCTGGCTATGGTCACAG
gtcagtactgcaggcgcagggcgcttcccctccagaactgcctagcaggatttgtcctga
gtttcccttgtcacagattctccttggttttgccaactagctaactgtcttgtacattct
tcttttgtttctgattatgttttctgcagagagacacgggctcaaggaacccaagagagt

 1.06 Term +   7889   8145  257  0  2   78   47   146 0.997   5.25
tcctgcattgctgccctggctatggtcacaggtcagtactgcaggcgcagggcgcttccc
ctccagaactgcctagcaggatttgtcctgagtttcccttgtcacagattctccttggtt
ttgccaactagctaactgtcttgtacattcttcttttgtttctgattatgttttctgcag
AGAGACACGGGCTCAAGGAACCCAAGAGAGTGGAAGAACTGCAAAACAAGATTGTAAATT
GTCTCAAAGACCACGTGACTTTCAACAATGGGGGGTTGAACCGCCCCAATTATTTGTCCA
AACTGTTGGGGAAGCTCCCAGAACTTCGTACCCTTTGCACACAGGGGCTACAGCGCATTT
TCTACCTGAAATTGGAAGACTTGGTGCCACCGCCAGCAATAATTGACAAACTTTTCCTGG
ACACTTTACCTTTCTAA
gacctcctcccaagcacttcaaaggaactggaatgataatggaaactgtcaagagggggc
aagtcacatgggcagagatagccgtgtgagcagtctcagctcaagctgccccccatttct
gtaaccctcctagcccccttgatccctaaagaaaacaaacaaacaaacaaaaactgttgc

Predicted peptide sequence(s):


>NR4A2_1|GENSCAN_predicted_peptide_1|598_aa
MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSF
STFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSV
YYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQ
SPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHA
SQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCL
ANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSP
PVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGW
AEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFG
EWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVT
FNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF