GENSCAN 1.0	Date run: 15-Jan-104	Time: 21:51:29

Sequence NFE2L2_1 : 36778 bp : 42.83% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1161   1358  198  2  0  -28   53   272 0.489  10.73
accccagctggcagtcccttcccgcccccggaccgcgagcttcttgcgtcagccccggcg
cgggtgggggattttcggaagctcagcccgcgcggccggcgggggaaggaagggcccgga
ctcttgccccgcccttgtggggcgggaggcggagcggggcaggggcccgccggcgtgtag
CCGATTACCGAGTGCCGGGGAGCCCGGAGGAGCCGCCGACGCAGCCGCCACCGCCGCCGC
CGCCGCCACCAGAGCCGCCCTGTCCGCGCCGCGCCTCGGCAGCCGGAACAGGGCCGCCGT
CGGGGAGCCCCAACACACGGTCCACAGCTCATCATGATGGACTTGGAGCTGCCGCCGCCG
GGACTCCCGTCCCAGCAG
gtgctgcctcggccctctgggccctgcggtggtgccgggacgggggcgggggagctaggg
aaccgcggcccgggagggacagccgcaaccggcttcccccacgtctggccagagccagga
ccgcggcgctgggtagagccgccgcgcttgcgccggggcagggcggggaggggcagcggg

 1.02 Intr +  31619  31885  267  1  0   70   92   314 0.149  26.81
attcattgaatggaattaactgtgctcttctagaacattggatctgtgttctcatttaga
ttgtatttgtaatctccccacttcccaccatcaacagtggcataatgtgaattaatttat
gtggtatctgtcatttaaaaaacatgagctctctccttcctttttttgtcttaaacatag
GACATGGATTTGATTGACATACTTTGGAGGCAAGATATAGATCTTGGAGTAAGTCGAGAA
GTATTTGACTTCAGTCAGCGACGGAAAGAGTATGAGCTGGAAAAACAGAAAAAACTTGAA
AAGGAAAGACAAGAACAACTCCAAAAGGAGCAAGAGAAAGCCTTTTTCGCTCAGTTACAA
CTAGATGAAGAGACAGGTGAATTTCTCCCAATTCAGCCAGCCCAGCACATCCAGTCAGAA
ACCAGTGGATCTGCCAACTACTCCCAG
gtacagagtactcagttcttgggaaagttatggcaggtttaaggaaacactgagcaagga
attaaaatatctggatttgagttccagctttgcctttcttttacttaaccttgtcaaatc
tactttccaacctcagcctcctgatgagttcagtacctaacctgagttcagtacccaacc

 1.03 Intr +  32551  32640   90  0  0   81   78    84 0.983   5.97
gctaagatctgaacccatgtggtctagttcaaattgtgcatcaaagtgatctctgaaata
agataaatatttacttaacttgattataaatattttatgaacatcaattattgaatattt
agcttggcaatggaatatttaaccatttttgttttcctttgtgtcattcccttttatcag
GTTGCCCACATTCCCAAATCAGATGCTTTGTACTTTGATGACTGCATGCAGCTTTTGGCG
CAGACATTCCCGTTTGTAGATGACAATGAG
gtgaggtataaaataacctggttaatagaaaaactccatcataactataaaataacaatc
tattctatgtaagtcccgtcaatgaatctccatttaaaagaataaaaacatttttaggag
gaaattttttaaccaaggaaatactcttgtcaaggaaaccttagcctataaataacttta

 1.04 Intr +  33307  33498  192  0  0   63   93   164 0.782  13.17
aaatttgagtcagtggggtaggaaaaaaagatttgttatttacaaacggggtcatgactg
gttagtaagtagagagacacagaactgcagctgattccattttgttttgtagtggtgcct
tagagcttactcatcccctgttggtggaagactcataaatcaatgccttatcaattttag
GTTTCTTCGGCTACGTTTCAGTCACTTGTTCCTGATATTCCCGGTCACATCGAGAGCCCA
GTCTTCATTGCTACTAATCAGGCTCAGTCACCTGAAACTTCTGTTGCTCAGGTAGCCCCT
GTTGATTTAGACGGTATGCAACAGGACATTGAGCAAGTTTGGGAGGAGCTATTATCCATT
CCTGAGTTACAG
gtaactaaaatagaatgtaatactggagattttttttatattcagtgcctttagtcattc
tgattatttatataccacctatttataggaaggattggagggtgctattaacttagtcat
gagtactgcccatgctagttaaattggttggacatcttgaggatagaatgttataaacct

 1.05 Term +  33882  35105 1224  2  0   59   33   910 0.997  73.22
aaataatacataacgcttaggcgtaaatatgtattggaaatgagaattatctctgaatta
tagataataaattatagagataagcctgaagataatgtgggtagggagtttatctaaatt
tatcacgtattatcatggattaactttgatttatatagtataaacttccttctcatgcag
TGTCTTAATATTGAAAATGACAAGCTGGTTGAGACTACCATGGTTCCAAGTCCAGAAGCC
AAACTGACAGAAGTTGACAATTATCATTTTTACTCATCTATACCCTCAATGGAAAAAGAA
GTAGGTAACTGTAGTCCACATTTTCTTAATGCTTTTGAGGATTCCTTCAGCAGCATCCTC
TCCACAGAAGACCCCAACCAGTTGACAGTGAACTCATTAAATTCAGATGCCACAGTCAAC
ACAGATTTTGGTGATGAATTTTATTCTGCTTTCATAGCTGAGCCCAGTATCAGCAACAGC
ATGCCCTCACCTGCTACTTTAAGCCATTCACTCTCTGAACTTCTAAATGGGCCCATTGAT
GTTTCTGATCTATCACTTTGCAAAGCTTTCAACCAAAACCACCCTGAAAGCACAGCAGAA
TTCAATGATTCTGACTCCGGCATTTCACTAAACACAAGTCCCAGTGTGGCATCACCAGAA
CACTCAGTGGAATCTTCCAGCTATGGAGACACACTACTTGGCCTCAGTGATTCTGAAGTG
GAAGAGCTAGATAGTGCCCCTGGAAGTGTCAAACAGAATGGTCCTAAAACACCAGTACAT
TCTTCTGGGGATATGGTACAACCCTTGTCACCATCTCAGGGGCAGAGCACTCACGTGCAT
GATGCCCAATGTGAGAACACACCAGAGAAAGAATTGCCTGTAAGTCCTGGTCATCGGAAA
ACCCCATTCACAAAAGACAAACATTCAAGCCGCTTGGAGGCTCATCTCACAAGAGATGAA
CTTAGGGCAAAAGCTCTCCATATCCCATTCCCTGTAGAAAAAATCATTAACCTCCCTGTT
GTTGACTTCAACGAAATGATGTCCAAAGAGCAGTTCAATGAAGCTCAACTTGCATTAATT
CGGGATATACGTAGGAGGGGTAAGAATAAAGTGGCTGCTCAGAATTGCAGAAAAAGAAAA
CTGGAAAATATAGTAGAACTAGAGCAAGATTTAGATCATTTGAAAGATGAAAAAGAAAAA
TTGCTCAAAGAAAAAGGAGAAAATGACAAAAGCCTTCACCTACTGAAAAAACAACTCAGC
ACCTTATATCTCGAAGTTTTCAGCATGCTACGTGATGAAGATGGAAAACCTTATTCTCCT
AGTGAATACTCCCTGCAGCAAACAAGAGATGGCAATGTTTTCCTTGTTCCCAAAAGTAAG
AAGCCAGATGTTAAGAAAAACTAG
atttaggaggatttgaccttttctgagctagtttttttgtactattatactaaaagctcc
tactgtgatgtgaaatgctcatactttataagtaattctatgcaaaatcatagccaaaac
tagtatagaaaataatacgaaactttaaaaagcattggagtgtcagtatgttgaatcagt

Predicted peptide sequence(s):


>NFE2L2_1|GENSCAN_predicted_peptide_1|656_aa
PITECRGARRSRRRSRHRRRRRHQSRPVRAAPRQPEQGRRRGAPTHGPQLIMMDLELPPP
GLPSQQDMDLIDILWRQDIDLGVSREVFDFSQRRKEYELEKQKKLEKERQEQLQKEQEKA
FFAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPF
VDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGMQQDIEQVWE
ELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNYHFYSSIPSMEKEVGNCSPHFLNA
FEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFYSAFIAEPSISNSMPSPATLSHSL
SELLNGPIDVSDLSLCKAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHSVESSSYGDT
LLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQSTHVHDAQCENTPEKE
LPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVDFNEMMSKEQ
FNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKS
LHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKPDVKKN