GENSCAN 1.0	Date run: 16-Jan-104	Time: 00:44:11

Sequence MRPL35_1 : 15789 bp : 41.55% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1235   1328   94  1  1   88   54    68 0.389   4.01
ttctataggcagtcgttttacagcggcgaagaacggaacccggcagatgacattgaataa
atgttgagtggacaactttgttcttttcctcttccttgactccgcctccttgctttccct
tcattctcttttgctcttgtgcttttaaacccaaagcggccgccgtaggcgaaggtgaag
ATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGTCAGTGGAGAGCGACA
TACTCCATGCATGCCTTCACAGAAGGGGAAACTG
gtgcgggatggaatgggcgtttagactggaggttaacaagcaaaaagggtcattatttaa
gttaagaaggttgcgcccaattttctctggggcggtgtgaccggcagcccgtaccaagtc
ccccgactcggactcacgcgggcctgtgtgtcacgcatttgccgcttccttaccagcttt

 1.02 Intr +   7850   8039  190  0  1   89   48   139 0.942   7.72
taaaatcagtaattaatttatggttataccttagtaaggtggtaaaagcttcacagatga
gtctgatgctcagggcacgttaattatgtttaatacttggtggcagtgatacatctctta
atttttaatatctggatgcatattttggagtattaaatatatatgctcctatctttacag
GAATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAACTGTGTCAAGAATG
CCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGACACCAGTTGTTT
CCTCCACTCCCAGACTTACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGA
TCCTTAATAG
gtagagtatatttctttgtggggttttttttgttttttgttttttgtttttttttgagac
ggagtctcactctgttgcccaggccagagtgcagtggtgcattctcagctcactgcaacc
tccacctccggggttcaagcaattctcctgcctcagcctcctaagtagctggaaagttct

 1.03 Intr +   8927   9071  145  2  1   31  113   144 0.736  10.56
ttggtgatggttgctattctaatttatgcttaatgtcatgggtcattggaagtaatattg
tatatgaaaagttagttccagtccattggagcagctttactcatttctcagtatagataa
tgaattttaatcctttaatcagtctgattacaagctaaaaattttaaaatatatttttag
AATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCAGTCAGATCTCTAACATACTTCAG
TGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCA
TTGTGGCCTTTGGGTGAGGAGAAAG
gtgagtcttcacactgttactaaattgaaaaaggaatgtgaggccgggcgtggtggctca
cgcctataatcccagcactttggcgggtggatcataaggtcaggagttcaagaccagctt
ggccaacatggtgaaactccatctctactaaaaatacaaaaattaggcgtggtggcaggc

 1.04 Term +  12224  12412  189  1  0   65   36   118 0.592   0.77
ccccctccccgccaccctcccttcccccggccattgagaatcacatctttccaagaaata
gtccagcccctatggaagtctggtttttgttcttattgggtctataaaccttgagttgtg
aagatacctgttgtttcatacatagtatgatgttttacatttctttgtaatatctgacag
GCTGGCTATAAGAAAAAATTATGGAAAAAGACACCTGCAAGGAAGAAGCGATTGAGGGAA
TTTGTATTCTGCAATAAAACCCAGAGTAAACTCTTAGATAAAATGACGACGTCCTTCTGG
AAGAGGCGAAACTGGTACGTTGATGATCCTTATCAGAAGTATCATGATCGAACAAACCTG
AAAGTATAG
atcagaagtttcacttgtttctcagttattggatatgtatctttgtgtacatatctttgc
aaaaatggataagtacaaaacttgatgtaaattgtaccaatgaatacgtaaacatacagt
gacaacattaaacttagaaaagttttaaaacttaatggatcagactttgccagatttggt

Predicted peptide sequence(s):


>MRPL35_1|GENSCAN_predicted_peptide_1|205_aa
MAASAFAGAVRAASGQWRATYSMHAFTEGETGILRPLNILASSTYRNCVKNASLISALST
GRFSHIQTPVVSSTPRLTTSERNLTCGHTSVILNRMAPVLPSVLKLPVRSLTYFSARKGK
RKTVKAVIDRFLRLHCGLWVRRKAGYKKKLWKKTPARKKRLREFVFCNKTQSKLLDKMTT
SFWKRRNWYVDDPYQKYHDRTNLKV