GENSCAN 1.0	Date run: 15-Jan-104	Time: 23:03:46

Sequence MARCO_1 : 54886 bp : 44.38% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   8733   8835  103  2  1   96  102    22 0.830   4.80
aagcctataggatcctttccagtgacttctgctcctaaaccacagaagtgccctacagtg
gggttagagttgctggtggtaggaatagtaatggatttaagcactgggttaggaaaggaa
aggaaaaagatagactaagctttccttagctttaatttggtagggcttgacccaggaaca
ATGGCCCATGATTCTGAGGATAATGGCACTTGCTTGACTCAGGTGTCATGTGTCCATCCC
TTTCCGCTGTACGAACAGCAGTCTCGATGGTTAGCAGCACAAG
gtacggtccttccaaggctggcccgagtttcccttctttctatcctttgatgagaatgtg
atccccaggctgatgctgatgtactggaaactccaagggcggcatctgtgctaaaagacc
ttttgtttcaagggaagagaaggtggaggataaaccaagtatataatttctaagaaattg

 1.02 Intr +  28192  28293  102  2  0   87   98   141 0.719  15.15
ttttgctttgtggcaagaaagaggattgggggatgatttgggagtcatgagcttttggtg
tctttcccagctgacctcacagggtgccccctgctcacatggagtagggcctggagcagg
cagggacttcctgtgctgtgttctctgcagcagcctccttcctcctggcttgtgtttcag
TTCCAAAGCCCAAGAGGAGAAATGGGGTGAACTTCTCCCTAGCTGTGGTGGTCATCTACC
TGATCCTGCTCACCGCTGGCGCTGGGCTGCTGGTGGTCCAAG
gtaaagcaggcttggtcctgtgtagtccctcctggggggagaggggtgacccagctgggc
ccctcagatgaagggctcaggttgagtggagagcctcgggccactgctcccatctgctgg
gagacagtctcagcccctggcagccacagtgatgagaggagcaaagaaggagtgtatgtt

 1.03 Intr +  29146  29345  200  2  2  -28   41   212 0.693   3.97
gtggagcgcacatggtcaagatgtagaaaaggccgtgtgctcacgctaggtcctgacagc
acatggaatttgtgtttacaaattcagggcctgtagaagttatgcacacatgacacaaga
atgtcagggatatgctcaaatgcctcagtccctaaaagaatgctgtggggtggggcccag
TTCTGAATCTGCAGGCGCGGCTCCGGGTCCTGGAGATGTATTTCCTCAATGACACTCTGG
CGGCTGAGGACAGCCCGTCCTTCTCCTTGCTGCAGTCAGCACACCCTGGAGAACACCTGG
CTCAGGGTGCATCGAGGCTGCAAGTCCTGCAGGCCCAACTCACCTGGGTCCGCGTCAGCC
ATGAGCACTTGCTGCAGCGG
gtagacaacttcactcagaacccaggtttggcctcctcccctctgggtcaggacttctca
acagaggtctgggagacagcgggatcaggaaccaggaaattaaggaccctgtccaagcaa
agtgtgacctccaagagccagggacttagagcaaccagctcaatgccaagtctgaaccca

 1.04 Intr +  30531  30566   36  2  0  134   96    42 0.867   8.06
aggactctttcccaaaaaacagccaggtgcttggctcctgttgtccaaacccccacagtc
tgatgggagccccacacaggagggcttaccctcccactgcagaacctgggcactctcagt
tggggcttgggccaagggtaccccacagctcagctgcagctcactctccttcccttgcag
GGATGTTCAGAATCAAAGGTGAACAAGGCGCCCCAG
gtaggttcatttccactcacacccaccctgctctttccccaaaacctccccaaaagggcc
ccttggcctgtgccattctgggtctggacagctgaccctagcttaccttcccctgtctcc
acagcctcctttgtcttcagttgggtctcctctctgttcccagaacttaactggactccc

 1.05 Intr +  33193  33292  100  0  1  141  103   -24 0.868   4.08
tggtccccacgtggtaatctcaggacatccctgtgtaattagtacactaattccatctta
ctgatgagggagctgaggctcaaaatgatgatgtaacttgcacaaggtcacccagctaaa
ggggcagtgctaacacctgctcctaggactgtgactcagtgtctctcttttgctttctag
GCCATGGGTTTCTTGCAGGAGGAGCTCTGTCTTCTTTCCTTCTTTCCACACAGTTGGCTC
ATCCCCATGCTCAGTGAACGTTTGTTGAATGAATCACCAT
gtaagtgattgcatggcgttgttgccccatcctgttgactgactcattagtgtctctgtt
cctcttcctcaggtcttcaaggtcacaagggggccatgggcatgcctggtgcccctggcc
cgccgggaccacctgctgagaagggagccaagggggctatgggacgagatggagcaacag

 1.06 Intr +  33365  33472  108  0  0  145   96    93 0.999  16.06
ctttctaggccatgggtttcttgcaggaggagctctgtcttctttccttctttccacaca
gttggctcatccccatgctcagtgaacgtttgttgaatgaatcaccatgtaagtgattgc
atggcgttgttgccccatcctgttgactgactcattagtgtctctgttcctcttcctcag
GTCTTCAAGGTCACAAGGGGGCCATGGGCATGCCTGGTGCCCCTGGCCCGCCGGGACCAC
CTGCTGAGAAGGGAGCCAAGGGGGCTATGGGACGAGATGGAGCAACAG
gtacgggtctttttcttctgacccttaatcattttcctcctccttctctggcttcactct
gaattccctttcccttccaggcccctcgggaccccaaggcccaccgggagtcaagggaga
ggcgggtgagtaggtgctgggtatgtacccagaaatacacagcaagtttctcagagtgac

 1.07 Intr +  33553  33597   45  2  0  136  100     1 0.957   4.48
ggtcacaagggggccatgggcatgcctggtgcccctggcccgccgggaccacctgctgag
aagggagccaagggggctatgggacgagatggagcaacaggtacgggtctttttcttctg
acccttaatcattttcctcctccttctctggcttcactctgaattccctttcccttccag
GCCCCTCGGGACCCCAAGGCCCACCGGGAGTCAAGGGAGAGGCGG
gtgagtaggtgctgggtatgtacccagaaatacacagcaagtttctcagagtgactgctg
tgggctgcagacgcagcctccctccagagtctggacctctgaggggtctgtaggtgaacg
gaggcctggtgggagaccccagaggggatgagaggctgggaagcaccctttctggtggcc

 1.08 Intr +  36503  36547   45  0  0  132   53    28 0.806   2.08
tgattgtgtgtgtgcatgtgtgtgaaaaagagagagagagagagagtgagagtgagagag
agagaaagatctccttctgggaaccttgctcaactaagggaatctagaatgtcagctgat
taaagacattttagacattctcaggccacagcaactgagctcttttttccttcctcacag
GCCTCCAAGGACCCCAGGGTGCTCCAGGGAAGCAAGGAGCCACTG
gtaacttgtacttgctctgctagggacaaatgatgcatagcctgaggcactgaggcagtt
cccccccaccccccatcctctttccacagccccaccccagcccctgacagttactgccca
ccctacagtcctcttctcttgagtcctgtcacatttcttcaagaccacccaagaaatgag

 1.09 Intr +  36860  36967  108  0  0   84   94    85 0.955   8.96
cttctcttgagtcctgtcacatttcttcaagaccacccaagaaatgagctagcacatccc
ccagaggaaatctggggatcccattcccttctctcccaaatgcttcctgcccctttgcct
ctggtagcctgtccccaaaaggatagtgggagcccatctcaccagccattctctttgcag
GCACCCCAGGACCCCAAGGAGAGAAGGGCAGCAAAGGCGATGGGGGTCTCATTGGCCCAA
AAGGGGAAACTGGAACTAAGGGAGAGAAAGGAGACCTGGGTCTCCCAG
gtgagggccgtattgggggtgtcggtgcttgccaggaggcctgagggaactagggcctga
cctctgtgccattgggtctattcagtgcccactgagggcaaggcagtgctctgtctatgg
gaatctctggagcaccacacatagtctcttctttccgggtgagcaaagagatgcaatatg

 1.10 Intr +  40441  40539   99  2  0   99  110    24 0.936   5.78
tctggggcaaagcggtgcactccttgagggcagcggtcatatcttccactcgcgggcacc
aagtaggagctcaaggagtttagggtttgggatttcagtggaatgggaagtgtcagagga
ggacatggtggcctgattggagttcctcccacaactaaccaagactttttggtttttcag
GAAGCAAAGGGGACAGGGGCATGAAAGGAGATGCAGGGGTCATGGGGCCTCCTGGAGCCC
AGGGGAGTAAAGGTGACTTCGGGAGGCCAGGCCCACCAG
gtaagagggcacgtggtcacatccactgacctctaggtatttccttttttttttttttct
ggctggctgagccaaaggaaaaaaaaattcctaaaagttctttttcatcttaggtttggc
tggttttcctggagctaaaggagatcaaggtaagaactacaggaatctgggcatcatccc

 1.11 Intr +  40653  40688   36  1  0   53  116    30 0.589   0.53
gcaggggtcatggggcctcctggagcccaggggagtaaaggtgacttcgggaggccaggc
ccaccaggtaagagggcacgtggtcacatccactgacctctaggtatttccttttttttt
tttttctggctggctgagccaaaggaaaaaaaaattcctaaaagttctttttcatcttag
GTTTGGCTGGTTTTCCTGGAGCTAAAGGAGATCAAG
gtaagaactacaggaatctgggcatcatcccagctacgactgtccctggcagagtgaagc
tggggaccagacaccaccatcttttgcttcattgtagtattcacccagaacacctggggt
tttttagacatctggccctggccaagaggaacagagcagccagtgggcggtgggggcagg

 1.12 Intr +  41380  41442   63  2  0   90   92    20 0.516   1.29
tgcagggtgttccgggccctcctggtgcagtgggacacccaggtgccaagggtgagcctg
gcagtgctggctcccctgggcgagcaggtgaggtcctgggtcctatggtgggcacaggga
gtgatgtgtgaaaacctgcctagtccagcccttatgctctctgtggtgtctgttgtccag
GACTTCCAGGGAGCCCCGGGAGTCCAGGAGCCACAGGCCTGAAAGGAAGCAAAGGGGACA
CAG
gtaacagagggtgcagtgggtgagtaggtgggcttgctgggtggcaggatggatggagag
aaaaactgcttcttcttaggcccacggaggaggcagagggtcttctgtgccttggcctct
gaggttcctggttatgggggcagttgcccctgccaggaccccttaagcccaagggcctag

 1.13 Intr +  49621  49665   45  2  0   82  103    14 0.596   0.68
ttcatctgcagactgtctcttttcatgatctgctgaagaggctttaaacaatcgtggaga
accaatgtatctttccatctgcattaatcagacaaaaggtagaggttgtctaagattaaa
aatgtctaatacctaagttttattatctcctccccccccccttttttgttttgatcttag
GACTTCAAGGACAGCAAGGAAGAAAAGGAGAATCAGGAGTTCCAG
gtaaagggcaggctgcatcttcatccctcggagtgatgacggggaaggcctgccttctca
gagggcaggtcttgttgacattgaatgcacagctgtgaccttctcccaaagtggaggtta
agactccagggctctgtcactcaagcctcagatttctccgctgcaaaacctgggaaccac

 1.14 Intr +  50809  50907   99  2  0   84  116    20 0.877   4.48
agagttgagagatcagtgcagcccccagatggaccaaagacaggctgaacattcagatag
cccagccatgggggaggtctggcagttaaggataactcatttattaaacagtaatgccct
tgggtctctcttgggaaggcaaagcagggcacctgatcagggcagtgtctctccttccag
GCCCTGCAGGTGTGAAGGGAGAACAGGGGAGCCCAGGGCTGGCAGGTCCCAAGGGAGCCC
CTGGACAAGCTGGCCAGAAGGGAGACCAGGGAGTGAAAG
gtaaggcctctgcatctgattcctttgttcttaggactgtgctttacagccagttctgta
ccttaaaataggaaaggcgctgttttaagagttctggggattttcagaacccaggagggt
agaggtttatttccttgattgacaagtcttgtgctggggcttgccctaggcatggagcac

 1.15 Intr +  51464  51508   45  0  0   88   74    56 0.756   2.58
ttcctgctcagtcattgacacccgcaggacatcccatccccataatgccaggccacaggc
gagacccacggagcatctgaccactcccaaccctccacccgctccccactcatgcaaatg
caggcaaaggcgtcctgcctgggtttctttcaaaccgtgtgggttttctcctcatgacag
GATCTTCTGGGGAGCAAGGAGTAAAGGGAGAAAAAGGTGAAAGAG
gtaatcactatttatattatctttaatgtgtgctttaaagtcaattctgcacctgaaaat
tgtgtgtgttgggggaagagaccttggttctcaaataaatttctcattttggggaggagt
tgagggtctagtcccttgaatgagcctgcccacggcacagagcagcagtttctctcccca

 1.16 Intr +  52156  52332  177  2  0  116  119   144 0.999  20.19
aggctgcgtgccaggttgggttggcactgtaaagtgggatcttccaggctctggtgacag
tcaagcaggggcatttcttttccttaactgtagaactccaaaatgaaaagaaagagcccg
cacttacccaaagccccaaggggccttccttgcctctcccatgtgtgtttcttcacccag
GTGAAAACTCAGTGTCCGTCAGGATTGTCGGCAGTAGTAACCGAGGCCGGGCTGAAGTTT
ACTACAGTGGTACCTGGGGGACAATTTGCGATGACGAGTGGCAAAATTCTGATGCCATTG
TCTTCTGCCGCATGCTGGGTTACTCCAAAGGAAGGGCCCTGTACAAAGTGGGAGCTG
gtaagtgagtcatcagccgggggcctcttccccagaggtgtggatgtggctttctctcgc
tggtggggtgttggcaagtgactcagtgtggttttctttaaaagaaaaatattggtccaa
gcaaccaaaaagctctgcagtgcagggctccaggtatgcatccttccagcttggcaaccc

 1.17 Term +  53419  53552  134  2  2   80   46   109 0.984   4.15
acaacaacaacaacaaaaacaggctaagccagccatcagcacattgggccggaatgggcc
agaatgagtgagaagtcggcagtccacctcagatggaagctcccaggcgcacacgtggct
tctttgctttgactctaatcctacccttcttcctctgtctcttgctttctctctatcaag
GCACTGGGCAGATCTGGCTGGATAATGTTCAGTGTCGGGGCACGGAGAGTACCCTGTGGA
GCTGCACCAAGAATAGCTGGGGCCATCATGACTGCAGCCACGAGGAGGACGCAGGCGTGG
AGTGCAGCGTCTGA
cccggaaaccctttcacttctctgctcccgaggtgtcctcgggctcatatgtgggaaggc
agaggatctctgaggagttccctggggacaactgagcagcctctggagaggggccattaa
taaagctcaacatcattggctgtggctgagtgtcactgtgttcatacctcccatccccat

Predicted peptide sequence(s):


>MARCO_1|GENSCAN_predicted_peptide_1|514_aa
MAHDSEDNGTCLTQVSCVHPFPLYEQQSRWLAAQVPKPKRRNGVNFSLAVVVIYLILLTA
GAGLLVVQVLNLQARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQA
QLTWVRVSHEHLLQRGCSESKVNKAPQAMGFLQEELCLLSFFPHSWLIPMLSERLLNESP
CLQGHKGAMGMPGAPGPPGPPAEKGAKGAMGRDGATGPSGPQGPPGVKGEAGLQGPQGAP
GKQGATGTPGPQGEKGSKGDGGLIGPKGETGTKGEKGDLGLPGSKGDRGMKGDAGVMGPP
GAQGSKGDFGRPGPPGLAGFPGAKGDQGLPGSPGSPGATGLKGSKGDTGLQGQQGRKGES
GVPGPAGVKGEQGSPGLAGPKGAPGQAGQKGDQGVKGSSGEQGVKGEKGERGENSVSVRI
VGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNV
QCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV