GENSCAN 1.0	Date run: 15-Jan-104	Time: 22:57:01

Sequence KCNS3_1 : 56679 bp : 41.87% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.05 Term -    514    368  147  1  0   13   53   184 0.565   4.32
 1.04 Intr -    718    557  162  1  0   73   34   102 0.601   2.55
 1.03 Intr -   1687   1413  275  2  2  101   81   169 0.684  13.83
 1.02 Intr -   2510   2112  399  0  0   40   46   329 0.423  17.45
 1.01 Init -  12157  11332  826  1  1    1   41   477 0.041  29.21
 1.00 Prom -  13691  13652   40                              -4.65

 2.04 PlyA -  14526  14521    6                               1.05
 2.03 Term -  18315  18103  213  0  0  109   48    74 0.794   1.75
 2.02 Intr -  28528  26640 1889  2  2   15   53   583 0.034  33.87
 2.01 Init -  29194  28579  616  1  1   19   72   250 0.087  12.04
 2.00 Prom -  29690  29651   40                              -6.15

 3.04 PlyA -  29859  29854    6                               1.05
 3.03 Term -  31037  30732  306  2  0   88   36   408 0.746  29.73
 3.02 Intr -  37653  37575   79  2  1  108   90    25 0.316   3.33
 3.01 Init -  49165  48894  272  1  2   85   31   157 0.058   6.19
 3.00 Prom -  50026  49987   40                              -7.35

 4.01 Sngl +  53532  55007 1476  2  0  101   53  1648 0.952 157.87
ttttattgcatttcctgctttgcttttaatgtagcccatcctcctggaaagggcagatta
aaaataagcttggctgggcacggcaggacagagtgctaatatcatcttgtgctctttcca
ggtgcagcctgatcttcctcttctcccttgccagccagcactctgccttctgtatccacc
ATGGTGTTTGGTGAGTTTTTCCATCGCCCTGGACAAGACGAGGAACTTGTCAACCTGAAT
GTGGGGGGCTTTAAGCAGTCTGTTGACCAAAGCACCCTCCTGCGGTTTCCTCACACCAGA
CTGGGGAAGCTGCTTACTTGCCATTCTGAAGAGGCCATTCTGGAGCTGTGTGATGATTAC
AGTGTGGCCGATAAGGAGTACTACTTTGATCGGAATCCCTCCTTGTTCAGATATGTTTTG
AATTTTTATTACACGGGGAAGCTGCATGTCATGGAGGAGCTGTGCGTATTCTCATTCTGC
CAGGAGATCGAGTACTGGGGCATCAACGAGCTCTTCATTGATTCTTGCTGCAGCAATCGC
TACCAGGAACGCAAGGAGGAAAACCACGAGAAGGACTGGGACCAGAAAAGCCATGATGTG
AGTACCGACTCCTCGTTTGAAGAGTCGTCTCTGTTTGAGAAAGAGCTGGAGAAGTTTGAC
ACACTGCGATTTGGTCAGCTCCGGAAGAAAATCTGGATTAGAATGGAGAATCCAGCGTAC
TGCCTGTCCGCTAAGCTTATCGCTATCTCCTCCTTGAGCGTGGTGCTGGCCTCCATCGTG
GCCATGTGCGTTCACAGCATGTCGGAGTTCCAGAATGAGGATGGAGAAGTGGATGATCCG
GTGCTGGAAGGAGTGGAGATCGCGTGCATTGCCTGGTTCACCGGGGAGCTTGCCGTCCGG
CTGGCTGCCGCTCCTTGTCAAAAGAAATTCTGGAAAAACCCTCTGAACATCATTGACTTT
GTCTCTATTATTCCCTTCTATGCCACGTTGGCTGTAGACACCAAGGAGGAAGAGAGTGAG
GATATTGAGAACATGGGCAAGGTGGTCCAGATCCTACGGCTTATGAGGATTTTCCGAATT
CTAAAGCTTGCCCGGCACTCGGTAGGACTTCGGTCTCTAGGTGCCACACTGAGACACAGC
TACCATGAAGTTGGGCTTCTGCTTCTCTTCCTCTCTGTGGGCATTTCCATTTTCTCTGTG
CTTATCTACTCCGTGGAGAAAGATGACCACACATCCAGCCTCACCAGCATCCCCATCTGC
TGGTGGTGGGCCACCATCAGCATGACAACTGTGGGCTATGGAGACACCCACCCGGTCACC
TTGGCGGGAAAGCTCATCGCCAGCACATGCATCATCTGTGGCATCTTGGTGGTGGCCCTT
CCCATCACCATCATCTTCAACAAGTTTTCCAAGTACTACCAGAAGCAAAAGGACATTGAT
GTGGACCAGTGCAGTGAGGATGCACCAGAGAAGTGTCATGAGCTACCTTACTTTAACATT
AGGGATATATATGCACAGCGGATGCACACCTTCATTACCAGTCTCTCTTCTGTAGGCATT
GTGGTGAGCGATCCTGACTCCACAGATGCTTCAAGCATTGAAGACAATGAGGACATTTGT
AACACCACCTCCTTGGAGAATTGCACAGCAAAATGA
gcgggggtgtttgtgcctgtttctcttatcctttcccgacattaggttaacacagcttta
taaacctcagtgggttcgttaaaatcatttaattctcagggtgtacctttcagccatagt
tggacattcattgctgaattctgaaatgatagaattgtctttatttttctctgtgaggtc

Predicted peptide sequence(s):


>KCNS3_1|GENSCAN_predicted_peptide_1|602_aa
MIKTLSKIGIQGTYLNVIKAIYDKPTANIILNGEKLKAFSLRTGTRQGCPLTPLLFNIVV
EVLARAIRQEKEIKGIQIAKKEVKLSLFAGDMIVYLENSKDSSRKLLELIKEFSKVSGYK
INVHKSVALLYTNSDQAENQIKNSTPFTIAAKKIKYLGIYLTKESKDFYKENYKTPLKGI
IDKTNKWKHIPCSWMGRINILKMTILPKAIYKFNAIPIKIPPSFFTDLEKTILKSIWNQK
RAHITKARLSKKNKSGGITLPDFKLYYKAIVTKQHVFSEGRVKDKKPERRLRANHKATLR
QERKEHLPPLPPLHALAPNQGPWVILAGGGSSLLSSAPAAGHPSEAFGSVSPDKTGGRHQ
ECKRCSFLQMNEKGQSGVGGAGQALQCERRPARLAAAPAGKTGSLASQGGPPPDHSPPHS
PKADPKYLPRGFQINPATASTARSSRNRRSLRAPATAGSGDQRMRAPRARRPEGRKVLCG
RRPSGSCTRDLDHRRLGQQKEIARPKLVLKQSAKESTYSSSSCQCLPSVPLPEDSGTVQN
KMLCLIPPLTESEEKRNQSGPLSEGRMEEEVRGRCLQPTLRNKPGPRRGQRVVQKASLAS
LH

>KCNS3_1|GENSCAN_predicted_peptide_2|905_aa
MRTTTQHTRISGTFKAVCRGKFTALNAHKRKQETSKTDNLTSQLKELEKQEQTHSKASRR
QEITKITEELKEIETQKTLQKINESRSWFFEKINKIDRPLARLIKKKREKNQIDTIKSDK
GDITTDPTEIQTSIREYYKHLYANKLENLEEMDKFLDTYTLPRLNHEEVESLNRPITGSE
IEAIINSLPTKKSPGPDGFTAEFIREKEGILPNSSYQASIIMIPKPGRDTTKKENFRPIS
LMNIDAKILNKIRANQIQQHIKKLTHHDQVGFIPGMQDWFNICKSINVIQHINRTKDKSH
MIISIDAEKAFDKIQQPFMLKTLNKLGIDEMYLKIIRAIYDKPTANIILNGQKLEAFPLK
TGTRQGCPLSPLLFNIVLEILARAIRQEKEIKGIQLGKEEVKLSLFADDMIVYLENPIIS
AQNLLKLISNFSKVSGYKINVQKSQAFLYTNNRQTESQIMSEVPFALASKRIKYLGIQLT
RDVKDLFKENYKLLLNEIKEDTNKWKNIPCSWIGRIIIVKMATLPKVIYRFNAIPIKLPM
TFFTELEKTTLKFIWNQKRARITKTILSPKNKAGGITLPDFKLYYKATVTKTAWYWYQNR
DIDQWNRTEPSEIIPHIYDHLIFDKPDKKKKCGKDSLFNKWCWENWLAICRKLELDPFLT
SYTKINSRWIKDLNVRPKTIKTLEENLGNTIQDIGMGKDFMSKTPKAMATKAKIDKWDLI
KLKSFCTAKETTIRVNRQPTEWENIFAIYSSDKGLISRIYKELQQIYKKKTNNPINKWAK
DMNRHFSKEDIYAAKRHMKKCSSSLAIREIQIKTTMRYHLTPVTMAIIKKFRKPQLTPVL
SSRNQSKCRLFQETFPVYSLPSLIHAPNATQAPHLCACRMVFLGNITDIWWHQCLLHSKH
VGDVQ

>KCNS3_1|GENSCAN_predicted_peptide_3|218_aa
MVQLGPWLQMAQAPILDDFHVVLGLQVDRRTEVWEPLPRFQRMYGNAWKSRQKFATGAEP
SWRTSARAVQKGNVGLESHAESPLGHCQVELLAAFPGGLTTAFKSEQMTASIIEREKGCS
STPATEQSWMENVFDELRKEGFRRSNFSELKEEVRTHGKEAKNLEKRLEEWLTRIIGVEK
SLNDLTELKTMARELHDECTSFSSRFNQLEERVSVIED

>KCNS3_1|GENSCAN_predicted_peptide_4|491_aa
MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDY
SVADKEYYFDRNPSLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSNR
YQERKEENHEKDWDQKSHDVSTDSSFEESSLFEKELEKFDTLRFGQLRKKIWIRMENPAY
CLSAKLIAISSLSVVLASIVAMCVHSMSEFQNEDGEVDDPVLEGVEIACIAWFTGELAVR
LAAAPCQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESEDIENMGKVVQILRLMRIFRI
LKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEKDDHTSSLTSIPIC
WWWATISMTTVGYGDTHPVTLAGKLIASTCIICGILVVALPITIIFNKFSKYYQKQKDID
VDQCSEDAPEKCHELPYFNIRDIYAQRMHTFITSLSSVGIVVSDPDSTDASSIEDNEDIC
NTTSLENCTAK