GENSCAN 1.0	Date run: 15-Jan-104	Time: 22:38:02

Sequence KCNE4_1 : 4101 bp : 49.06% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1126   1266  141  2  0   81  111    71 0.811   9.02
ttcactcatcgtcaccgctacctgaaaaccctggccgggtgctggggcttgaggagcagt
tcccacttcccagtctttttcacttttcacagctgcaaagttcagggagttgaactgcag
tgctttcagttcactgctcactctgccacgatcaatctctgttgtaaattttcctcccag
AGCACGTGACGATGCACTTCTTGACTATATATCCCAACTGCAGCAGCGGAGTTGTCAGAG
CGCAGAGCCGGACAGAGCAGAAGAACCCTCTTGGACTGGACGATTTGGGAATTCAAAACT
TGGGACAAACTGTCAGCCTTG
gtaagtcagcaaggctacactttgctttcagaaacatttgaaagagggacatttttgcca
attaatagatgaatttttttcctttattttcttcctgcttttctttgttctaaggaaaca
ttgttttgaatttaaaatagtttggttttggaaacacaatgtaaactttgtttctgctca

 1.02 Term +   1800   2335  536  1  2   61   42   929 0.994  80.01
tcccgtgcactccaagccctcatagctcactcttgtcagctgtttggcgaaccctcttat
gctatttctttcatgcacttttaagcttttttggtattgcagttccacaaacctcgtgct
cccccacctccctgtgcccaggacctgggggagagttctaacctgcggctttttccccag
CCCCTGCTGTGGAGGCAGCCTCAATGCTGAAAATGGAGCCTCTGAACAGCACGCACCCCG
GCACCGCCGCCTCCAGCAGCCCCCTGGAGTCCCGTGCGGCCGGCGGCGGCAGCGGCAATG
GCAACGAGTACTTCTACATTCTGGTTGTCATGTCCTTCTACGGCATTTTCTTGATCGGAA
TCATGCTGGGCTACATGAAATCCAAGAGGCGGGAGAAGAAGTCCAGCCTCCTGCTGCTGT
ACAAAGACGAGGAGCGGCTCTGGGGGGAGGCCATGAAGCCGCTGCCTGTGGTGTCGGGCC
TGAGGTCGGTGCAGGTGCCCCTGATGCTGAACATGCTGCAGGAGAGCGTGGCGCCCGCGC
TGTCCTGCACCCTCTGTTCCATGGAAGGGGACAGCGTGAGCTCCGAGTCCTCCTCCCCGG
ACGTGCACCTCACCATTCAGGAGGAGGGGGCAGACGATGAGCTGGAGGAGACCTCGGAGA
CGCCCCTCAACGAGAGCAGCGAAGGGTCCTCGGAGAACATCCATCAGAATTCCTAG
cacccccgggacccctgccggtggctccatcagccagcaaccttagagagaggaaagaca
gttttcaagtgtctggtttcactttcacagtgcggctgccactttgaagagacccttggt
aaacccctgattcggggtggggtgggggactaggctcagccggaaccagcacctccaagg

Predicted peptide sequence(s):


>KCNE4_1|GENSCAN_predicted_peptide_1|225_aa
XHVTMHFLTIYPNCSSGVVRAQSRTEQKNPLGLDDLGIQNLGQTVSLAPAVEAASMLKME
PLNSTHPGTAASSSPLESRAAGGGSGNGNEYFYILVVMSFYGIFLIGIMLGYMKSKRREK
KSSLLLLYKDEERLWGEAMKPLPVVSGLRSVQVPLMLNMLQESVAPALSCTLCSMEGDSV
SSESSSPDVHLTIQEEGADDELEETSETPLNESSEGSSENIHQNS